KEGG   Elaeis guineensis (African oil palm): 105032109Help
Entry
105032109         CDS       T03921                                 

Definition
(RefSeq) protein HASTY 1 isoform X1
  KO
K14289  exportin-5
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105032109
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:egu03016]
    105032109
   03036 Chromosome and associated proteins [BR:egu03036]
    105032109
Transfer RNA biogenesis [BR:egu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    105032109
Chromosome and associated proteins [BR:egu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     105032109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 105032109
NCBI-ProteinID: XP_010904764
Position
Unknown
AA seq 1205 aa AA seqDB search
MDDSSSTASNVARAIAAALDWSSPPDTRKAAVAYLESVKSGDIRVLAKTSLLLVGKDWSS
EIRLHGFKMLQHLVRFRWDEFSIAERSEFANLTINLIFEMVSPREEWALKSQTAALVAEV
VRREGVALWHELLPSLVSLSNKGPIEAELVAMMLRWLPEDITVHNEDLEGDRRRVLLRGL
TESLTEILPLLYNLLEKHFGAALNEYAKQQLDIAKQHAATVTAALNAVNAYAEWAPVPDL
AKYGLVHGCGSLLPYHEFRLHACEFFKLVCQRKRPTDATAHEFNSAMSTIFQILMNVSRD
FLNRSRSNFHAIDESEFEFVECICESMVALGSSNMQCIIADGTMTSQFLQQMLEYYQHFK
IALHFQSLLFWLVVMRESLSKTKAAAQIAGDNSAVSNLGFGSGLAEKEKKGVSAFINDDI
CNAILDVSFQRMLKKNIAVGTSTTAEALELWSDEFDGKSDFSQYRSRLLELIRLIAFRKP
LVAAARVSHRIDSVIRNFVHASMSAQELVVVESMQLGLETVVGAIFDGSAEFVSSAPETK
FQLHSILEGLLQQLLSLKWTEPTLAVTLGRYLDAFGPYLKYYPDSVAGVVNKLFELLTSL
PFALKDPSSNNARHARLQICTSFIRIARAADKSLLPHMKGIADMMAYLQGEGRLLRGEHN
LLGEAFLVMASSAGIQQHQEVLAWLLEPLNKQWAPLEWQNAYLSEPFGLARLCSDTQFMW
SIFHTVTFFEKALKRSGTKKAMMNLQGCSAPTDISTYPHPMSSHLSWMLPPLLRLLRSVH
ALWSQPVAQALTSELRAAKSMSHVEQATLLGESNLKPPKGQVSFADGSQTDMNREGESNE
NDIRNWLKGIRDSGYNVVGLSATIGDAFFRCVESPSVALALVENVQSMEFRHMRQLIHLV
VIPLVKFCPADLWETWLENILHPLFLYCEQALTCSWSSLLHEGRAKVPDTFGNLSGLELK
VEVMEEKLLRDLTREICSLLSVLASPGLNSGLPSLEQLGPINRLEVSSLRDLDAFVSNSM
IGFLIAHKGLALPAMRISIEVFAWTDGEAVNKVIPFCGSLILLAISTNNVELREFVAKDL
FYAIIQGLALESNAIISADLVGLCREIYVYLADRDPAPRQILLSLPCIKREDLLAFEDAL
TKTSSPKEQKQHMRSLLLIATGNKLKALAAQKSTNVITNVTAKTRSSAVGASVEEDNVIG
LAAIT
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagcagcagtacggcgagcaacgtcgctcgggccatcgccgccgccctcgac
tggagctcccctcccgatacgcgaaaggcggccgtcgcctacttggaatccgttaaaagt
ggagatattcgcgtgttggcaaagacatctcttcttttggttggcaaggattggtcctct
gagattcggctacatggattcaaaatgttgcagcatttggttcgatttaggtgggatgaa
tttagtattgcagaacggagtgagttcgcaaatttaaccatcaatttaatatttgagatg
gtcagtcctcgtgaagaatgggcattaaagagtcagacagccgctttggttgctgaggtt
gtaaggagagaaggggtcgctctttggcatgagctgctaccatctttagtttctctatct
aataaaggtcctatagaggctgagttggttgcaatgatgctgagatggctccctgaagat
ataacagttcataatgaagacctagaaggtgatcgccgtagggtactgttacgtggactt
acagaatcactgacagagattttgccacttttatacaatttgcttgaaaaacactttgga
gctgctttgaatgaatatgctaaacaacagttagatatagcaaaacagcatgcggccaca
gtaacagctgctttgaatgctgtgaatgcatatgctgaatgggctcctgtccctgatctt
gccaaatatggtctggttcatggatgcgggtctttacttccttaccatgagtttcgcctc
catgcctgtgaatttttcaaacttgtttgtcaaaggaaaagacctactgatgctactgca
catgagtttaattctgcaatgagtaccatcttccagatcctcatgaatgtatccagagat
ttcttaaacagatctaggtccaattttcacgctattgatgaaagtgaatttgagtttgta
gaatgtatatgtgagagtatggtcgctttgggttcttctaacatgcaatgcatcattgct
gatggaaccatgacttctcaatttcttcaacagatgctggagtattatcaacattttaaa
attgcacttcactttcaatctttgctcttttggctggtggttatgagagaatcactatcc
aagacaaaagctgctgcacagattgctggggacaactcagctgtcagtaatttgggcttt
ggttctggactagcagaaaaggagaagaaaggggtgtcagcattcattaatgatgatatc
tgcaatgctattttggatgtttccttccagcgaatgctcaagaaaaatattgctgttgga
acctcaacaactgcagaggcattagaactgtggagtgatgagtttgatgggaaaagtgac
tttagccagtatcgttctagactgttggagctcataagacttattgcttttcgaaagcca
cttgttgctgcagcaagggtttcacatagaattgactcggttattagaaattttgtacat
gcgtcaatgtcagctcaggagctagttgtagtggaaagcatgcaattgggccttgaaaca
gttgtaggtgcaatttttgatggctcagctgaatttgtaagcagtgctcctgaaaccaag
tttcaattacacagtattcttgaaggtcttcttcagcagctcctttctttgaaatggact
gaaccaacacttgcagtaacacttgggcgatatttggatgcatttggtccctatctgaaa
tactatccagattcagttgctggtgttgtcaataaactttttgaacttttgacatcactc
ccatttgcactcaaggacccttcctcaaataatgctcgacatgctaggttgcaaatttgt
acatcttttattaggattgccagagctgctgataaaagccttcttcctcatatgaagggt
attgctgacatgatggcttatctccaaggagagggtcggttacttcgtggtgagcataat
cttctaggtgaagcatttcttgtcatggcatcttctgctgggattcagcaacatcaggaa
gtgttagcctggttacttgaacctttaaataaacagtgggcaccattagaatggcaaaat
gcttatttgtctgaaccatttggtctggcacgtctctgctccgacacacaatttatgtgg
tcaattttccatactgtaacattctttgagaaggctctgaaaaggagtggaactaaaaag
gctatgatgaatctacaaggatgttctgcacccacagatatttccacttatccccatccc
atgtcttctcatttatcatggatgctgccccctctactaaggctacttcgttctgtgcat
gctctttggtctcaaccagtagctcaagctttgacaagtgaactaagagcagcaaagagt
atgagccatgttgagcaggctactcttcttggggaaagcaatcttaaaccaccaaaaggt
caggtgagttttgctgatgggtctcagacggacatgaacagggaaggagagtcaaatgaa
aatgacataaggaactggttgaagggtatcagggacagtgggtataatgtcgtcggcctc
tcagcaactattggagatgcctttttccgatgtgttgagagtccatctgttgcactagcc
cttgtggagaatgtccaatcaatggaatttagacacatgcgccaactaattcatttagtt
gttattcctttggtcaagttctgtcctgcagatttgtgggagacatggctagaaaacatc
ttgcatccattatttctctactgtgagcaagctcttacttgttcatggtccagtcttctg
cacgagggtagagcaaaggttcctgatacctttggtaatctttctggactggagctaaag
gtggaagtaatggaagaaaagttgctgcgtgatttgactcgtgagatatgttctcttctc
tcagttttagcttcaccaggtctaaacagtggacttccatccttggagcaacttgggccc
atcaatcgcctggaagtgtcttcgcttagagatttggatgcttttgtctcaaattctatg
attggctttcttattgcgcacaaaggccttgctcttcctgcaatgaggataagtatcgaa
gtgtttgcatggacagatggtgaagcagtgaataaagttatccctttttgtggatctctc
attcttcttgctatatcaacgaataacgtggaacttagagagtttgttgctaaggatttg
ttctatgcaataattcaaggtctcgccctggagtcaaatgctattataagtgccgatctt
gttggtctttgtcgtgaaatatatgtctatctagcagatagagatcctgcacccagacag
attctgttgtcccttccttgtattaaaagagaagatctacttgcttttgaggatgctctg
acaaaaactagtagtcccaaagaacaaaagcaacatatgaggagcttgcttttaatagct
actggaaacaagttgaaagctcttgctgctcagaagagcacaaatgtcataaccaatgta
acagctaaaacccgtagctcggccgtcggagcaagtgttgaagaagataatgtcattgga
ttagcagccatcacgtga

DBGET integrated database retrieval system