KEGG   Elaeis guineensis (African oil palm): 105032124Help
Entry
105032124         CDS       T03921                                 

Definition
(RefSeq) probable nucleolar protein 5-2
  KO
K14565  nucleolar protein 58
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    105032124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:egu03009]
    105032124
Ribosome biogenesis [BR:egu03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    105032124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 105032124
NCBI-ProteinID: XP_010904781
Position
Unknown
AA seq 588 aa AA seqDB search
MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTTDALSAA
TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ
LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR
VREWYGWHFPELGKIIQDNIQYAKAVKLMGSRVNAANLDFSEILSEEVETELKVSAEISM
GTEVSDLDLANIRDLCDQVLALSEYRAQLYDYLRSRMNTIAPNLTALVGELVGARLIAHG
GSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIFHASLIGQAAPRFKGKISRSL
AAKTALAVRYDALGDSQDNSMGLENRAKLEARLRVLEGRELGRSAGSSKGKPKIEVYDKD
RKQGAGALITPAKTYNPASDLVLGGTTEPSGEQEGAPSKKRKHEDVEPTSAGEAPVREGE
DEEKKEKKKKKKKVEVESTKLENNDQVAVAAAEEPEKKKKKKKRKTEAQASELENQDQTD
LPEADQVPDMKEKKKKKKKKKHAEAHEEPEAQTQSKKKEKKKKEKKHE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcttttcgagactcctgcaggcttcgccctattcaaagttctggatgagggg
aagctctccaaagttgaggacttgtggaaggagtttgcgacatctgaatcagccagacag
gtggtaaaattgaaggcattcagtaaatttgagaacactacagacgctctatcagcagca
accttgttgattgatggcaagccaagcaagggtctccgcaagtttctgcgtgctcattgt
gatggcgaaacattagctgtggctgattccaaacttggaaatgcgataaaagaaaaactg
aaaatagattgccttcacaacaatgctgtcatggagctgatgaggggattgagaaaccaa
ctgacagaactcatatcaggattggctgtgcaggatttggctccgatgagtttagggttg
tcacacagcctatctagatacaagctaaagttcagccctgataaggttgatacaatgatt
attcaggcaattggcttgttggatgatcttgacaaagagctcaatacttatgccatgaga
gttcgtgaatggtatggctggcattttccagagcttgggaaaattatacaggacaatatt
cagtatgcaaaggcagtgaagctgatgggtagtcgtgtaaatgcagcaaaccttgatttc
tctgagatattgtcggaggaggttgagacagagctgaaagtatctgcagaaatatccatg
ggaactgaagtcagtgacctagacttagcgaatattagagacctatgtgatcaagtactt
gctctttcagagtatagagctcaattgtatgactacctgagaagcagaatgaatactatt
gcaccaaacttgacagcacttgttggggaattagttggagctcgtcttatagctcatggt
ggcagtttactgaatttggcaaaacaacctggaagcacagttcagattcttggtgcagag
aaggcactttttagagctctgaagacaaagcatgctacacccaaatatggtcttatcttc
catgcatccttaattggtcaagcagctcccagattcaagggaaagatatctcgttcccta
gctgcaaagacagcactggccgttagatatgatgcccttggtgatagtcaagacaactct
atgggattagagaatcgtgccaagcttgaagctcgcttgagggttctcgagggcagagaa
ctgggtcgttctgctgggtcatcaaaaggcaagcccaagattgaagtttatgataaagac
cgaaagcaaggtgcaggggcattgattactccggccaagacttacaatccagcatctgac
ttggtgcttggaggaaccactgagccatctggtgagcaggaaggagcaccttcaaagaag
aggaagcatgaagacgtggaaccaacatctgctggggaggctcctgtccgagagggggaa
gatgaagagaaaaaggagaaaaagaagaagaaaaagaaagttgaggtagagagcaccaag
ttggaaaataatgaccaggttgctgtagcagctgcagaagagccagagaagaagaagaag
aagaagaagaggaaaactgaagctcaagccagtgaattggagaatcaggatcagactgat
ttaccagaggctgatcaggtccctgacatgaaagaaaagaagaagaagaagaagaagaag
aagcatgctgaagcgcacgaggaaccagaagctcaaacgcaaagcaagaaaaaggagaag
aagaaaaaagagaaaaagcacgagtga

DBGET integrated database retrieval system