KEGG   Elaeis guineensis (African oil palm): 105032162Help
Entry
105032162         CDS       T03921                                 

Definition
(RefSeq) probable glutathione S-transferase GSTF1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00480  Glutathione metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105032162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egu02000]
    105032162
Enzymes [BR:egu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105032162
Transporters [BR:egu02000]
 Other transporters
  Pores ion channels [TC:1]
   105032162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N
Motif
Other DBs
NCBI-GeneID: 105032162
NCBI-ProteinID: XP_019701739
Position
Unknown
AA seq 169 aa AA seqDB search
YHCNQLEILNLTESRAIARYVARKYKSSGPDLLREGDLQESAVVDQWMEVEAHQYNPAMS
PIVFQLFVIPMRGGVPDQQVIDNSLVELEKVLDIYEDRLSKSKYLAGDFFSPADLNHLPL
THYFMTTPYKSLFKSCPHLNGWWEDWSSRPAVKKVTDAMDYAVIPGCKS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
tatcattgtaaccagttggaaattctgaatctaacagaatcacgagcaattgcaaggtat
gtggcgcgcaagtacaagtcctctggtcctgacctgctgagggagggtgatttgcaggag
tcagcagtggtggatcaatggatggaagttgaggctcatcaatacaacccagccatgtct
cctattgttttccagttgtttgttatccccatgcgtggaggggtccctgatcagcaagtc
atcgacaacagtttggtggagctagagaaggtccttgacatatacgaggaccggctgtcc
aagtccaaatacttggcaggagacttcttcagtcctgctgatcttaaccatttgcctctc
actcactacttcatgaccactccttataaatcgctcttcaaatcgtgcccacatctcaat
ggatggtgggaagactggtcgtcaagacctgcagtcaagaaggtgactgatgcaatggat
tatgctgtcattcctggctgcaagtcttag

DBGET integrated database retrieval system