KEGG   Elaeis guineensis (African oil palm): 105033642Help
Entry
105033642         CDS       T03921                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00010  Glycolysis / Gluconeogenesis
egu00562  Inositol phosphate metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105033642
   00562 Inositol phosphate metabolism
    105033642
Enzymes [BR:egu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105033642
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105033642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105033642
NCBI-ProteinID: XP_010906825
Position
Unknown
AA seq 564 aa AA seqDB search
MCPAFAFSWFFLRGGKKKPRNRSLQGRQIDFSTDYFLTACQEGSMAFAFSTFFLVLLLAP
SLLLLHPSAGESFDVRQHLSTVTRYDAVKDSNNANFVPSAIPDGCKAIHLNLVARHGTRS
PTKKRIKELDQLAIRLDTILNDARGSQKDSSLQKIPKWLSGWQSPWKGRQKGGELTSKGE
DELYHLGLRVRERFPELFEEEYHPDIYSVRATQVPRASASAVAFGMGLFSGKGSLGPGRH
RAFSVLSESRASDICLRFYDTCETYKEFRRSQEPAVEKLKEPILDEITSSLVTRYQLNFT
RQDVASLWFLCKQEASLLEITDQACGLFSAYEVSLLEWTDDLEVFLLKGYGKAINYRMGV
PLLQDIVQSMEEAIMAKEENRTPGIFEKARLRFAHAETVVPLTCLLGLFLEESEFEQIQR
EQPLCLPPKPPQKRNWRCSIVAPFSGNNVLALYQCPGNNSSDIMLSGAHRSKYFVQVLHN
EIPTPLPGCGDTDFCPFDVFKERVVNPHLKHDFHSVCNVKLELPEAKIEQIESCSLICKL
SNLFRRLFVLKRSNTYTKNQKTEL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctgcctttgctttctcctggttctttcttcgcggggggaaaaagaagccaagg
aatcgctctttacaagggcgtcagatcgatttctcaactgattatttcctcaccgcttgc
caggaaggaagcatggcgttcgccttctccacctttttcctcgtacttctcctggccccc
tctctcctcctcctccacccgtccgccggcgaatcgttcgacgtccggcagcacctctcc
accgtcaccagatacgatgctgtaaaagactccaacaatgccaattttgtgccttctgct
ataccagatggatgcaaagcaatccacttaaatcttgtggcaaggcatggaacccgctct
ccgactaaaaaacgcatcaaagagttggatcagctggctattcgcttggatactattctg
aatgatgcaagggggtcacaaaaagattcttccttgcagaagattccaaagtggttatca
gggtggcagtccccttggaaaggaagacagaaaggtggtgagctaactagcaaaggggaa
gatgaattataccatctaggacttagagtgagggaaagatttccagaattgtttgaggag
gaatatcaccctgatatttactcagtaagggcaacccaggttcctcgtgcttcagctagt
gctgtggcatttggcatggggctgttctctgggaaaggaagccttggaccagggcggcat
cgtgctttttctgtgctaagcgagagccgtgccagtgacatttgtctacgtttctatgac
acttgtgaaacttacaaggaatttaggcgcagtcaggaacctgctgttgaaaagctcaaa
gaaccgattttggatgaaattacttcttcattagtcactcgttaccagctgaatttcaca
agacaggatgttgcctctctttggtttctttgcaaacaggaagcatccttgttggaaatt
actgatcaagcttgtggcctgttcagtgcttatgaggtctctttacttgagtggacagat
gacctggaggtatttctactaaaaggttatggcaaagccattaattatcgcatgggagtg
ccattactccaagacattgttcaatcaatggaggaagcaatcatggctaaagaagaaaac
cgcacccctggaatttttgagaaggcaaggctccgctttgcacatgctgagacagttgtg
cctttgacctgtctgctcgggctctttcttgaggaatctgaatttgagcaaatacaaaga
gagcaacccttatgcctgcctccaaagcctcctcagaaaagaaattggaggtgcagtatt
gtggcacctttttctggaaataatgtgttagctttgtaccagtgtcctggtaataattct
agtgacatcatgctgtctggagctcacagaagcaagtatttcgtgcaagttctacacaat
gaaatcccaactcccctgccgggttgtggcgacacagatttttgcccattcgacgttttc
aaggaacgagttgtcaacccccatctaaagcatgactttcattcggtctgcaatgtgaag
ttggaattgccagaagctaagatagaacaaatcgagtcttgttccctgatttgtaagttg
tcaaatttattccgtagacttttcgttctgaaaagatcgaatacatacaccaaaaaccag
aagacggaattgtga

DBGET integrated database retrieval system