KEGG   Elaeis guineensis (African oil palm): 105033823Help
Entry
105033823         CDS       T03921                                 

Definition
(RefSeq) probable histidine kinase 5
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:egu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    105033823
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     105033823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 105033823
NCBI-ProteinID: XP_010907055
Position
Unknown
AA seq 997 aa AA seqDB search
MVALHKGTGLSRLWKSRDQQVQQPKHYQQQNSQGGGKWRKKFLFVGVLVGLLVSIWIFLG
MNASIITRRKETLANMCDERARMLQDQFNVRMNHVHALAILVSTFHHGKNPSAIDQKTFA
EYTARTAFERPLTNTVAYALKVLHSQREEFESQHGWKIKKMEIENQSPVEDDFTHGKLDP
SPDQDEYAPVIFSQEAVSHVISIDMMSGKEGCDSILRARASGKGVLTSPFILLKANHLGV
VLTFAVYNSNLPPDATLQERIEAAVGYIGASFDISSLVEKLLHQLASKQTIVVNVYDTTN
SSAPIRMYDPDVTGAGECHISNLDFGDPLRQHEMHCRFKHEPPLPWSAITTSLGVAVIVL
LVGHIFYAALNRIEKVEDDYCEMRELKVRAEAADVAKSQFLATVSHEIRTPMNGVLGMLR
MLMDTELDATQQDFAITAQASGKALIALINEVLDQAKIESGRLELEAVPFDVRDVLDNVL
SLFSDKSKGKGIELAAYVSDWVPEILIGDPGRFRQIIMNLVGNSVKFTEEGHIYVSVHLV
EEVKSSCDVSNQVKRNYEDGTDMSYNTLSGFCIVERWKSWENIRMFKMPTEASDSVNLLV
TVEDTGVGIPQDAQSRIFTPFMQADSSTSRTYGGTGIGLSISRCLVDLMGGEIGFVSKPG
IGSTFSFTAVFREGRKNAVDMKRHHPDPLLDFQGMRGLVVDGRSIRAEITKYHLQRLGIR
VDIALTPKSALSAVLEACNANGTGHLDVVLIDKEAWGEHSGLAFMHPLAELRKNDMMKPQ
ENLPKMFLLATSLSPTEVDDLKSAGYTDTMMKPLRLSMIVACLQKALGVGNKRQREKGQV
MALQSLLNGKQILVVDDNAVNCKVAAGALKKYGAVVTCADSGKAAIEVLQPPHKFDACFM
DVQMPEMDGFEATRHIRSVETKVNGLIKSGEASSKMYGNVAQWHIPILAMTADVIQATHE
ECIRCGMDDYVSKPFEEEQIYSAVAHFFEPDTVESIS
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcccttcataaaggaactggtcttagcagattgtggaagtccagggatcaacaa
gttcagcagccaaagcattatcaacaacaaaattctcagggtggtgggaaatggaggaag
aaatttctatttgtaggggtcttagttggacttttggtatctatttggatatttttaggc
atgaatgcaagcattattacaaggaggaaggagactcttgcaaacatgtgtgatgagaga
gcacggatgttgcaagatcagtttaatgtgagaatgaaccatgtgcatgcattggccatt
ctggtttctacttttcaccatggaaaaaacccttctgcaattgatcagaaaacttttgca
gaatatacagccagaacagcatttgaaaggccactgacaaatactgttgcttatgcttta
aaagttcttcattctcagagggaggaatttgagagccagcatggatggaagataaagaaa
atggagattgagaatcagtcccctgttgaagatgatttcacgcatgggaagcttgacccc
tcacctgatcaagatgaatatgcacctgttatattctcccaggaagctgtgtctcacgtc
atttccatcgatatgatgtctgggaaggaaggctgtgacagcatattgagagcaagggcg
tcagggaaaggtgtactgacatcgccttttattcttttgaaagccaatcacctaggagtg
gttcttacatttgccgtatataattccaaccttcctccagatgctaccctgcaagagcgc
attgaagctgctgtaggatacattggtgcatcatttgatatctcatctttggtggagaag
cttcttcaccagcttgccagcaaacaaaccattgttgtgaatgtgtatgacacaactaac
tcatctgcccctattaggatgtatgatcctgatgtcactggtgctggtgagtgtcatatc
agtaatttggattttggggatccacttcgtcagcatgaaatgcactgcagattcaagcat
gagcctccgctaccttggtcagcaataacgacatcactaggtgttgcagttattgttttg
cttgttggtcatatattttatgcagcactgaaccgtatagagaaggttgaagatgattat
tgtgaaatgagagagctgaaagtccgagcagaagctgctgatgtagcaaaatcacagttt
ctagcaacggtttcccatgagatcagaactcccatgaatggtgtcttaggtatgctgcgg
atgctgatggacacagaacttgatgcaacccaacaagattttgcaattactgctcaagct
agtggaaaagctctgattgctctaataaatgaggtccttgatcaggctaagatagaatct
ggcaggcttgagctagaagctgttccttttgatgttcgtgatgttctggacaatgtgctg
tctctattttctgacaagtcaaaggggaaaggcatagaattggcggcatatgtgtctgac
tgggttccagagattctcattggggaccctgggcggtttagacaaatcatcatgaatctt
gttgggaattcagtgaagttcacagaagaagggcatatatatgtctcagtgcacttggtg
gaggaagtgaagagctcatgtgatgttagcaaccaagtcaaaagaaattatgaggatggt
acagacatgtcatataacacattgagtggattttgcatagtagagagatggaaaagctgg
gagaatatcaggatgttcaagatgccaacagaagctagtgattcagtcaacttgttggtg
acagttgaagacactggtgtaggaatacctcaagatgctcaaagccgtatttttacacct
tttatgcaagcggacagttctacttcaaggacatatggtggaactgggataggcttgagc
ataagcagatgtttagtggatctaatgggcggagaaataggatttgtgagtaaaccaggg
attggtagtacattttctttcactgcagtgtttcgggaagggcggaagaatgcagttgat
atgaagaggcatcatcctgatcctctgttggatttccagggaatgagagggctggtagtt
gatggaagaagcatacgtgctgagatcacaaaatatcatctacaaagattggggatacgt
gttgacattgcccttactccaaaatcagcactttctgctgtattggaagcatgcaatgca
aatgggacagggcatttggatgtggtgcttattgacaaggaggcttggggtgagcactca
ggtcttgcattcatgcaccctcttgcagagctcaggaaaaatgatatgatgaaacctcaa
gaaaatcttccaaagatgttcttgttggcaacctccctaagccccactgaggttgatgat
ttgaagtcagcaggatatacggatactatgatgaaaccccttcgcctaagcatgattgtt
gcttgtcttcaaaaagcattaggtgtgggaaacaagagacagcgagaaaaaggacaagtc
atggcacttcaaagtcttctgaatgggaagcagattctagttgttgatgacaatgcagtc
aactgcaaggttgctgcaggtgctttgaagaaatatggagctgtagttacatgtgcggac
agcgggaaggctgctattgaagtgctccaacctcctcacaagtttgatgcttgctttatg
gatgttcaaatgccagagatggatggctttgaagccacaaggcatatccgctctgtggaa
actaaagtgaatgggctgatcaagtctggagaagcatcatccaagatgtatgggaatgtt
gctcagtggcatataccaatattggccatgacggctgatgtaatccaagcaacacatgaa
gaatgtatacgatgtggtatggatgattatgtgtcaaagccatttgaagaagagcaaatc
tactctgctgtggcacatttctttgagcctgatacggtggagtcaatatcatag

DBGET integrated database retrieval system