KEGG   Elaeis guineensis (African oil palm): 105036876Help
Entry
105036876         CDS       T03921                                 

Definition
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A-like
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00562  Inositol phosphate metabolism
egu01100  Metabolic pathways
egu04070  Phosphatidylinositol signaling system
egu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105036876
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105036876
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105036876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egu04131]
    105036876
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     105036876
Membrane trafficking [BR:egu04131]
 Endocytosis
  Macropinocytosis
   Kinases
    105036876
 Endosome - Golgi transport
  Others
   Others
    105036876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 FYVE zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 105036876
NCBI-ProteinID: XP_010910903
Position
2
AA seq 1771 aa AA seqDB search
MNTMCHACGSEKTPLDSGYYCKICHHPICQECEKRDSSSALDDEYPVGHCKSCLEKYGKE
SLRMDGLSPYFTPLISPAPSLSSYGSCVSSLGDFPADLSSQKRENGVESLDTGQKHPDLR
FTEHLENHRNRNSFKDIDIQSSPAKVNADGLEVSISTEGKISSLMLASVGHVDGSGEKYG
LYNGMSGDVQSTRVGDDSDGTENAFDSSSPAFLSNFEKDPLIWTPPEPEDMEDDIDSVAN
FDDDDDYGDGTKWGQPSSLSSLDEENGSAYSFKEERQKAMLEAMNGQFKILASRLLASEG
LNFSGREGGESWLDIVASLSWEAALLIKPDASEGRAMDPGSYVKVKCIASGTRNQSQVIK
GLVFKKNAAHKRMPTKFRNPRLLLLQGALGHSAVGLSSFDSMEKEKNHLKSIIEMIETCQ
PNVVLVEKTVSRDIQESLLAKGITLVFDMKLPRLIRIARCTASPIICSADILMKLKLKQC
ESFHIERFVEEHNICGEGGKRPSKTLMFFEGFPKPLGCTILLKGAHSDELKKVKRVVYYT
VFAAYHLILETSFFADQRLFFSGKNFVREGSGSFKDKAVLLASCDASPYSDISSIECSTS
SITPVHALDIPISDGRLQKYAHEQMASISDLGAERSSLSPQLNPAVSSLGDSVDHRDLFC
DKLRGSRFLRYDSSALLKRGQVLSSFSVSSKKYLGKSFQSHTSESDSSFSGFNEKMLDLP
IFSSLEMLDRDKEATATIHQEKPDDRNINNAKPGLVSDISEPIERCTCDVSDQVEMQNKD
DIQSVLDPQSILVLLSTQCITKQAVCEENHLSRINYYGNFDVSLGRFLQDVLLNKKHCCS
SCGEPPESHVYRYTHQNGTLTVLVRQLRPESRLSGEGEGKIWMWTRCLRCARQGGIPKST
RRVVMSTAARGLSFGKFLELSFSSHSSASRLSKCGHSLHRDCLRFFGLGSKVAMFRYSSV
EIYTACKPPPVIEFHNPHGQEWFKREMQNVLARAHLFFSEVAKMLQTLKLKHLIPISKQY
MDISGSVEEFSEVEEMLIQEKTEFEASLLKAINHSEQLGMTVHEVFGLNWLNQELLLLLY
VWDHRLHHLLQHKQVQQKKDGSTCNVFVERNMLEDGEKILGAPSQILMDVNESSSSSGNC
HAQDIQTELQIESVDDSGDTSSRAQNFLDAGFSEIGSSAEQISDRSTVEEHSAYFLDQDY
GSKPGDVSTPTGRGENGQEAQIPISDDMLVDHSIQVARERNLERVPDLELKIDETTNNRE
MSTMSMSKDHPRMSREFSNSKLEDPNNWIWAPFSELRRAYKRDLHGGSLQKFEFVNTYTP
VHLSPMRQPSASEMGLLHFMVGPGGNVLSVSEDEISSIIACALAISQDRHGLLDSMAEKE
AGESKGETDKTIVKSNSLLSNGSIASSVWSSTGCADYEGIQSSQSGSSISSEEPSTPYSD
GSSSVDRLLASDDLHPEIPVGYGKVAGKTKYSVVCIYAKQFYALRKKWCPSELAYISSIS
RCKKWDAQGGKSKAFFAKSMDDRFIIKQIKKTELDSFLKFGPDYFKHISHSIESGSQTCL
AKIVGIYQVRQYKSGKEVKTDLMVMENLLFGHSFSRIYDLKGAVFSRYVPDTNDHGKVLL
DQNFIEDMRVSPIYIGGRTKHLLQRAIWNDTAFLTSINVMDYSLLVGVDKQRHELVFGII
DYLRQYTWDKQLETWVKSSLVVPKNSLPTVISPKEYKKRFRKFMTKYFMAVPDTWSSERC
SDPCKFCIADSSNSFNVHSKKLPEQPIEACA
NT seq 5316 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaatgtgtcatgcatgtggctcagaaaagacacctctggatagtggatattac
tgtaaaatttgccatcatcccatctgtcaggagtgtgagaaaagggatagttcttcagcc
ctggatgatgaatacccagtggggcactgtaaatcctgtctggagaagtatgggaaagag
tctttaagaatggatggtttgagtccttacttcactcctctgattagtcccgcaccctct
ctgtcaagctatgggagttgtgtttcaagccttggtgatttccctgctgatttgagttca
caaaagagggagaatggagttgagtctctggatactggtcaaaagcatccagacctacga
tttactgaacacttagaaaatcatagaaacagaaattcattcaaagatatagatattcag
tcttctcctgctaaggtcaatgcagatggactggaagtttccatttcaacagaaggaaaa
atttcatcccttatgttagcatcagtgggccatgtagatggcagtggcgagaaatatgga
ctttataatggcatgtcaggtgatgttcaatccacgagagttggcgatgattcagatggg
acagagaatgcctttgacagcagtagtccagcattcttatccaatttcgaaaaagatcct
ctcatctggacaccacctgaaccggaagacatggaagatgacattgatagtgtcgctaat
tttgatgacgatgatgactatggtgatggtacaaaatggggtcaaccaagttcgttaagc
agtcttgatgaagaaaatgggagtgcttacagttttaaagaagagcggcaaaaggcaatg
ttggaagcaatgaatggacaatttaaaattcttgcaagtcggcttttggcctctgagggc
ctcaacttttctggaagagagggtggtgagagttggctcgacattgtggcatcattatca
tgggaagccgcgcttcttatcaagcctgatgctagcgagggaagggcaatggatcctggg
tcatatgtgaaggtgaaatgtatcgcatctggtactcgcaatcaaagtcaagtgatcaaa
ggcttagttttcaagaagaatgcggcacataaacgcatgccaaccaagttcagaaatcct
agacttcttctccttcagggagccctaggtcattcagcggttggtttgtcatcatttgat
tcaatggaaaaggaaaagaatcatttaaagtctataattgagatgatagaaacatgtcag
ccaaatgtagtgctggtcgagaaaactgtttcacgtgacatacaagaatcccttcttgca
aaaggaatcacactggtgtttgatatgaagcttccgcgcttgataagaattgcacgatgt
actgcttctcccatcatttgttctgctgacattctgatgaaactgaagctgaagcaatgt
gagtctttccatattgaaagatttgtggaggagcataacatctgtggtgaaggtggaaag
aggccgtccaaaactttaatgttttttgagggttttccaaaacctttgggttgtacgata
ttgctgaaaggagcacatagtgatgaactgaagaaggttaagcgtgtggtgtattacaca
gtctttgcagcataccacttgattcttgaaacttcattctttgcagatcaaaggttattt
ttctccggcaaaaattttgtaagggaaggttctggttcttttaaagataaagcagtgctc
ttagctagttgtgatgcttcaccttattcagatatttctagtattgaatgttccacttct
agcatcactccagtgcatgcactagatattccaatttctgatggacgattacaaaaatat
gctcatgagcaaatggcatcgatatctgatctgggtgctgaaaggtcttctttgtcacct
caattaaatcctgctgttagttcgcttggtgatagtgttgatcacagagatttgttttgt
gataaactacgcggtagcagattcctccgatatgattcatcagcattgcttaaacgtggg
caggttctatcatctttctcggtttcttctaagaaatatttaggcaaaagcttccaatct
cacacttctgagtctgattcatcgttctctggcttcaatgagaagatgcttgatctccct
atcttttcatctttggagatgcttgatcgtgataaagaagcaactgctactattcatcag
gaaaagcctgatgatagaaacatcaataatgcaaagcctgggctagtctcagatatctct
gagcctattgagcgttgcacttgtgatgtcagtgaccaagttgaaatgcaaaacaaggat
gatattcagagcgtattagatcctcaaagtatattggttttgctgtccacccagtgtatc
acaaaacaagctgtttgtgaggagaaccatctttctcgtataaactattatggaaatttt
gacgtatcacttggacgatttctgcaagatgttttactcaacaagaaacattgttgctct
tcatgtggtgaaccaccagagtcgcacgtataccgttacacccaccagaatggaactctt
actgttcttgtcaggcaacttcgtccagagtcacgtctgtctggtgaaggtgaaggaaag
atttggatgtggactagatgtttaagatgtgcgcgtcaaggtgggattccaaaatcgaca
cgaagggttgtaatgtcgactgcagcgcgtggtctctcatttgggaagttcttagagctc
agcttttcaagccactcctcagccagtaggttatcaaagtgtggacattcattgcatagg
gactgccttcgattttttggattaggctccaaagttgccatgttcagatattcatcagtc
gaaatctatactgcatgtaagccaccaccagtcatagagttccataatccccacggacaa
gagtggtttaagagagaaatgcaaaatgttcttgctagagcacatctgtttttctccgag
gttgcaaagatgctgcaaacattgaagcttaaacatcttattccaatctcgaaacagtat
atggatatatcagggtcagtcgaagaattttctgaagtggaagagatgctgattcaagaa
aaaactgagtttgaggcttctttgctaaaagctattaatcatagcgagcagctgggaatg
actgtgcatgaggtttttggtttaaattggctaaaccaggagcttctccttctgctgtat
gtttgggaccatcgtttgcatcaccttctacagcataaacaagtacaacaaaagaaggat
ggcagtacatgcaatgtatttgtcgaaagaaatatgctagaagatggtgaaaagattttg
ggagctccaagtcagattcttatggatgttaatgaatcctcttcttctagtggtaactgt
catgctcaagatatacaaactgagctgcaaattgagtcagttgatgactctggcgacaca
agcagcagagcccaaaattttcttgatgcagggttttctgaaattggaagttcagctgag
cagatttcagatagatcaacagttgaggagcattcagcatattttcttgaccaagattat
ggtagcaaaccaggtgatgtatctactcctactggacgtggtgagaatggccaagaagca
caaattcctatttctgatgacatgctggtagaccactctatccaggttgcaagagaacga
aaccttgaaagggttcctgacctggagctaaaaattgatgagacaactaataaccgtgaa
atgtctacgatgtccatgtccaaggaccatccaagaatgtctcgggagttctccaattcc
aaattagaagacccaaacaactggatatgggctcctttttctgaattgcgaagggcatac
aaaagggatcttcatggtggttcattgcaaaagtttgaatttgtcaatacttacactcct
gtccacctgtctccaatgcgtcagccatctgcctcagaaatgggcttgttgcacttcatg
gttggtccaggtggcaatgttttgtcggtctcagaagatgagatatcaagcattatagct
tgtgcgctagccatatctcaggatcgacatgggttgttggatagcatggctgaaaaagaa
gcaggggagagcaaaggagagactgataaaacaatagtaaagtctaacagcctgctatct
aatggttctatagcttcttctgtttggtcatctactggatgtgcagactatgaaggaatc
caatcatcgcagagtggttcgtcaatttcatcagaggagccgtccaccccttattctgat
ggttcatcttctgtggatcgcctgctagcttcagatgatctgcatcccgaaattcctgtc
ggatatggaaaagttgctggaaagactaaatactcggtagtgtgcatatatgcaaaacaa
ttctatgctctcaggaagaaatggtgcccatcagaacttgcctacatatcttccataagt
cgttgtaagaagtgggatgctcaaggagggaagagtaaagccttttttgcaaagtcaatg
gatgacaggttcatcataaaacaaattaagaagacagagcttgattccttcttgaagttt
ggccctgattactttaagcacatttctcattctatagaatcgggaagccaaacatgtctt
gctaaaattgttggaatataccaggttagacaatacaaaagtggtaaagaggttaagact
gatttaatggtgatggaaaatcttctgtttggacatagtttttcacgcatatatgatctc
aaaggagctgtcttttcccgatatgttccagatacaaatgaccatggaaaggttcttttg
gatcaaaacttcattgaagatatgcgtgtttcacctatttatattggtgggagaaccaaa
catcttctccaacgggccatttggaatgatacagcttttcttacttcgatcaatgtaatg
gattactccttacttgttggagtggacaaacagcggcatgagcttgtatttggcattata
gattacttgaggcagtacacatgggacaaacaacttgagacatgggtgaagtcttctttg
gttgttcctaaaaattcattgccaactgtgatttccccaaaggagtacaagaaaaggttt
aggaagtttatgaccaaatacttcatggcggtcccggatacttggagttccgaacgatgt
tcagatccctgcaaattttgtattgctgacagtagcaattcatttaacgtacacagcaaa
aagctgccagaacagccaattgaggcttgtgcatga

DBGET integrated database retrieval system