KEGG   Elaeis guineensis (African oil palm): 105037491
Entry
105037491         CDS       T03921                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00100  Steroid biosynthesis
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
Module
egu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    105037491
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     105037491
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT
Other DBs
NCBI-GeneID: 105037491
NCBI-ProteinID: XP_019703389
UniProt: A0A6I9QI68
Position
Unknown
AA seq 369 aa
MEAEAILAALIPSWSSVILLTFYLGYLAVAGFILPGRVVPGAILPDGTRLHYRCNGLVSL
LMLLALLGTGFYMKWMSPTVIADKGVELLSTTFMFSLFVSLVLYAAGLKSCSQSSSLKAH
ATGNFIHDWWFGVQLNPHFMGIDLKFFYVRAGMMGWLLINLSLLAKSYVTGTANLSVILY
HLFCALYITDYFFFEELMTSTWDIIAERLGFMLVFGDLVFIPFTFSIQGWWLLKNKVELT
KVAAIANFLTFIIGYLVFRGANKQKHVFKKNPKAHIWGKPPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGASSVIPYFYPIYLLILLIWRERRDEARCSQKYKEVWAEYCKMV
PWRILPFVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggaagcagaggccatactcgctgcactgatcccttcttggagctccgtcattctgctg
accttctacttgggctacctggcagtagctggatttattcttcccggcagggttgtgccc
ggagccattctgccagacggcacaagactccactaccgatgcaatggtctggtatcatta
ttgatgctgctggcactcctggggactggattttacatgaaatggatgtctcctacggtc
atagcagacaaaggtgtcgagctactgtcaacaacctttatgttcagcctctttgtttct
ttggtgctttatgctgctggcttaaagtcctgtagtcagtcttcctctttgaaagcacat
gccacaggaaactttattcatgactggtggtttggcgtacaactcaatccccattttatg
ggaattgacctcaaattcttttatgtgagagctggaatgatgggatggttattaatcaat
ctctctctattggcgaagagctatgtaactggcactgcaaacctttcagtcatcctttac
caccttttttgtgcgttgtatattacagactatttcttctttgaggaattgatgacctcc
acgtgggacattattgcagaaaggttgggttttatgctggtctttggagatctagttttc
atccctttcacatttagtattcagggttggtggcttttgaaaaacaaagtggagctaaca
aaagttgcagctatagccaatttcttgacttttatcattggttatttagtattcagagga
gccaacaagcagaaacatgtattcaagaagaaccctaaagctcacatatggggtaaacca
ccaaaagttattggaggaaagttgcttgcttctggttactggggtattgcaagacattgc
aattaccttggagatctgctgctggcactttctttcagtttgccatgtggggcgagttct
gtgattccgtacttttatcctatctaccttcttattctacttatatggagggagaggaga
gatgaagcaaggtgttcgcagaagtacaaggaagtctgggcagagtactgcaagatggtt
ccatggaggatactaccttttgtgtattag

DBGET integrated database retrieval system