KEGG   Elaeis guineensis (African oil palm): 105040911Help
Entry
105040911         CDS       T03921                                 

Definition
(RefSeq) sirohydrochlorin ferrochelatase, chloroplastic isoform X1
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00860  Porphyrin and chlorophyll metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    105040911
Enzymes [BR:egu01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     105040911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-GeneID: 105040911
NCBI-ProteinID: XP_010915962
Position
3
AA seq 293 aa AA seqDB search
MYTQKKQQKEILAKNKECIYQLIPQSHFLPLPIYRFALALLGRPPLPPYGARFRRRTRLL
GRPFDLADLNFEVDHWLWKAYWVLKYRLGLCTRPRFLRKFSPLDVRDPPKLHFPVFHKLS
RITAKGRTLSTKCCLSVRGEGLERFEHSVGDKDAVIIVDHGSRRQESNFMLDEFVAMFKA
RTGYRIVEPAHMELAAPSIRDAFETCVLQGAKRVIVSPFFLSPGRHWHQDIPALAAEASR
EHSGISYIITAPLGLHELMVDVMNDRIKHCLSHVAADADECTVCAGTGKCRLY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtatacccaaaaaaagcaacagaaagaaattctagccaaaaataaggagtgtatatat
caactgataccgcaatcccattttcttccccttccgatctaccgcttcgccctagcgctt
cttgggcgacctcctcttcctccttacggcgctcgctttcgtagacgaactcgccttctt
gggcgccctttcgacctcgccgacctgaactttgaggtggaccactggctttggaaggcc
tattgggtgctaaaataccgtctcgggctatgcactcggccacgattccttcgcaagttt
tctcctttagatgtaagggatcctcctaaattgcattttcctgtgttccacaagttgtcg
agaattacggcaaaaggaagaactctgtcgacaaagtgctgtctaagtgtcagaggcgaa
gggcttgaaagatttgaacactcggtgggagacaaagatgccgtgatcatcgttgatcat
ggatctcgacggcaagaatctaattttatgctggatgagtttgttgccatgttcaaagct
aggactggttataggatagtggaacctgctcatatggaattggctgcaccatcaatcagg
gatgcatttgaaacatgtgtgctacaaggagcaaaacgagttattgtcagtccatttttc
ctctccccaggacggcattggcatcaggatatccctgcgttagcagctgaggcatccagg
gagcactcaggcatatcctatatcatcacagcacctcttggtctgcatgagcttatggtg
gatgtgatgaatgaccgaataaagcactgcctgagccatgtagctgctgatgctgatgag
tgcactgtatgtgctggaacaggaaaatgtcgtttatattga

DBGET integrated database retrieval system