KEGG   Elaeis guineensis (African oil palm): 105044500Help
Entry
105044500         CDS       T03921                                 

Definition
(RefSeq) glutathione S-transferase DHAR2 isoform X1
  KO
K21888  glutathione dehydrogenase/transferase [EC:1.8.5.1 2.5.1.18]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00053  Ascorbate and aldarate metabolism
egu00480  Glutathione metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    105044500
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105044500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egu02000]
    105044500
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.1  glutathione dehydrogenase (ascorbate)
     105044500
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105044500
Transporters [BR:egu02000]
 Other transporters
  Pores ion channels [TC:1]
   105044500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4 GST_C_5 GST_C Tom37 GST_C_3
Motif
Other DBs
NCBI-GeneID: 105044500
NCBI-ProteinID: XP_010920727
Position
5
AA seq 216 aa AA seqDB search
MAATPVEVCVKAAAGAPDILGDCPFSQRVLLTLEEKKVPHEKKLINVENKPDWFLTISPE
GKVPVFKCDDDKWVPDSDVITQIIEEKYPNPSFVTPQEFSSVGSKIFPSFVKFLKSKDPN
DGSEQALLDELRALDEHLKAHGPYVNGENISAVDLSLAPKLFHLEIVLDHFKGWKIPENL
TYVHAYMKLLFNRESFIKTKPAKEHVIAGWAPKVNA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacacccgtcgaggtctgcgtcaaggccgccgccggcgctccggacatcctc
ggcgactgcccttttagccagagggttcttcttacgctggaggagaagaaggtgccccac
gagaagaagctgattaacgtcgaaaacaagcccgattggttcttgacgatcagtcccgag
gggaaggtgccggtgttcaagtgcgacgatgacaaatgggttcccgattcggatgtcatc
acccagatcatcgaggagaaataccccaacccttcttttgttactccccaggagttctcg
tcggtgggatcaaaaatattcccgtcttttgtcaagttcttgaaaagcaaggatcccaat
gatgggtcggaacaagcattgcttgatgaattgcgtgcactggatgagcatctcaaagct
catggtccatatgttaatggtgaaaatatatctgcagttgacttgagcttggcacctaag
ttgttccatcttgagatcgtccttgatcattttaaaggatggaagataccagaaaatttg
acatatgttcatgcttacatgaagctacttttcaatcgggaatcattcataaagaccaag
ccagcaaaggagcacgtgatcgctggatgggcacccaaagttaatgcttga

DBGET integrated database retrieval system