KEGG   Elaeis guineensis (African oil palm): 105045634Help
Entry
105045634         CDS       T03921                                 

Definition
(RefSeq) probable protein S-acyltransferase 16
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egu04131]
    105045634
Enzymes [BR:egu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105045634
Membrane trafficking [BR:egu04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    105045634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC PUNUT
Motif
Other DBs
NCBI-GeneID: 105045634
NCBI-ProteinID: XP_010922288
Position
5
AA seq 283 aa AA seqDB search
MSRQGYITLPIFVVLATVAFLYYSTVFLVIDEWMGLRTAAGLGNAIVFTFLTLMAVGNYC
IAVFRDPGRVPSSFMPDVEEAENQIHEIKRKGGDLRFCQKCSHYKPPRTHHCRVCKRCVL
RMDHHCVWINNCVGHENYKVFIIFVLYGVIACIHSMVLFVGNFIHDAQKDQPQSSYSNKT
TCIIGGAILFPLALALSVLLGWHIYLILQNKTTIEYHEGVRAMWLAEKVGNMYRHPYDLG
VYENLVSVLGPNIFCWLCPGSKFKGSGLRFRTAFDLPISTTLT
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccagggatacatcacgcttcccatcttcgtcgtgctcgcaaccgtggccttc
ctctactactcgaccgtcttcttggtgatcgatgagtggatggggctgcggaccgcggcg
gggctggggaatgccattgtcttcaccttccttaccctaatggcggtggggaactactgc
atcgctgtgttcagggatccgggccgcgtgccttcgtcgttcatgcccgacgtggaggaa
gcagaaaaccagatccacgaaatcaagaggaagggtggagatctgagattttgccagaag
tgttctcactataagcctccccgtacgcatcactgtcgtgtttgcaaaagatgtgttttg
agaatggatcaccactgtgtttggataaacaattgcgttgggcatgaaaactataaggtc
ttcattatttttgtgctgtatggtgtgattgcctgcatccactcaatggttctttttgtt
ggaaattttattcatgatgcgcagaaggatcagccacagagtagttactctaataaaaca
acatgtatcattggtggagctatactgtttcccttagctctggcgttaagcgtcctattg
ggttggcatatataccttatcttgcagaacaagaccacaattgagtaccatgaaggagtc
agagccatgtggctggcagaaaaagtaggaaatatgtatagacatccatatgaccttggt
gtctacgaaaaccttgtttcagtgctagggcctaacatcttttgttggttatgccctggg
tcgaagttcaaaggctctggtctccgatttcgcactgcatttgaccttccaatatctaca
acactaacttga

DBGET integrated database retrieval system