KEGG   Elaeis guineensis (African oil palm): 105045636Help
Entry
105045636         CDS       T03921                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP20-1
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105045636
Enzymes [BR:egu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105045636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C DUF5401 Sde2_N_Ubi
Motif
Other DBs
NCBI-GeneID: 105045636
NCBI-ProteinID: XP_010922289
Position
5
AA seq 188 aa AA seqDB search
MDDAVDLTGDGGVVKSVIRKARADASAPSDNLSLVDVHYEGTLADTGEVFDTTHEDNTVF
SFELGKGSVIKAWDIAVRTMKVGEVAKITCKPDYAYGSAGSPPDIPPNATLIFEVELVAC
RPRKGASLGSVSDEKARLEELKKQREMTAALKEEEKKRREEAKAAAAARIQAKLEAKKHQ
GKGKGKAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgcagtagatttgaccggggatggaggtgtagtcaagagcgttataaggaaa
gccagagctgacgcaagtgcaccatcagataacctttcccttgttgatgttcattatgaa
ggcacccttgctgacactggtgaagttttcgatactacacatgaagacaatactgttttc
tcatttgagcttggcaagggctcagttatcaaggcctgggatatagcagtaagaactatg
aaggttggggaggttgcaaaaattacttgcaagccagactatgcctatggaagtgctggt
tctcctccagatataccaccaaatgcaactctgatctttgaggtggaattggtagcttgc
agaccgcggaaaggtgccagtcttggtagtgtttcagatgaaaaggcaaggcttgaggaa
ttaaagaagcagagggagatgacagccgcactcaaagaggaagagaaaaaaaggagagaa
gaggcaaaggctgcagctgctgcaagaatacaagccaagttagaagcaaagaagcaccag
ggaaagggcaagggaaaagcaaaatag

DBGET integrated database retrieval system