KEGG   Elaeis guineensis (African oil palm): 105045690Help
Entry
105045690         CDS       T03921                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03040  Spliceosome
egu04141  Protein processing in endoplasmic reticulum
egu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105045690
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105045690
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105045690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egu01009]
    105045690
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:egu03041]
    105045690
   03009 Ribosome biogenesis [BR:egu03009]
    105045690
   03110 Chaperones and folding catalysts [BR:egu03110]
    105045690
   04131 Membrane trafficking [BR:egu04131]
    105045690
   03051 Proteasome [BR:egu03051]
    105045690
   03029 Mitochondrial biogenesis [BR:egu03029]
    105045690
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egu04147]
    105045690
Protein phosphatases and associated proteins [BR:egu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105045690
Spliceosome [BR:egu03041]
 Complex B
  Other components
   Prp19 complex
    105045690
 Complex C
   Prp19-CDC5 complex
    105045690
Ribosome biogenesis [BR:egu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105045690
Chaperones and folding catalysts [BR:egu03110]
 Heat shock proteins
  HSP70 / DNAK
   105045690
Membrane trafficking [BR:egu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105045690
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105045690
Proteasome [BR:egu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105045690
Mitochondrial biogenesis [BR:egu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105045690
Exosome [BR:egu04147]
 Exosomal proteins
  Proteins found in most exosomes
   105045690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 105045690
NCBI-ProteinID: XP_010922357
Position
5
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA
EEISSMVLMKMREIAEAYLGYTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKAASVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDITGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDSKMDKSSVHEVVLVGGSTRIPRVQQLLQDFF
NGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVKDDKISSKLTAEDKKKIEDAIEQAIQWLDGNQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGAGMNDDAPSAGGSGSGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaagggcgaaggtcctgcgatcgggatcgatctcgggacgacctactcttgc
gtcggcgtgtggcagcacgatcgggtggagatcatcgccaacgaccagggcaaccgcacc
accccctcctacgtcgctttcaccgacaccgagcggctcatcggcgatgccgccaagaac
caggtcgccatgaaccctaccaacaccgtcttcgatgccaagcgcctgattggccgtcgg
ttctctgatgcttctgtccagagtgatatcaagctctggcccttcaaggttattcctggc
cctggggataagcccatgattgttgttcagtacaagggtgaggataagcagtttgctgca
gaagaaatatcgtctatggtcctaatgaagatgcgtgagattgcagaagcctacctggga
tacactgtcaagaatgctgttgtcactgtacctgcctacttcaatgactcccagcgccag
gcaacaaaggatgctggagttattgctggccttaacgttatgcgaattatcaacgaaccc
acagctgctgctattgcatatggtcttgataagaaggctgccagtgttggtgagaagaat
gttcttatctttgaccttggtgggggcacttttgatgtctctctccttaccattgaagag
ggtatctttgaggtgaaggccactgctggggacacccaccttggtggagaagactttgac
aaccgcttggtgaaccacttcgtccaggagttcaagaggaaacacaagaaggacatcacc
ggaaatgctagggctcttaggaggctgaggacagcttgtgagagggcgaagaggaccctt
tcatctactgcccaaaccacaattgagattgattccctgtatgagggcatcgatttctac
tccaccatcacccgtgccaggtttgaagagcttaacatggatctcttcaggaagtgcatg
gagcccgtagagaagtgtctgagggattccaaaatggataagagtagcgtccatgaagtt
gtccttgttggtggctccactagaattccgagggtgcagcagttgttgcaggatttcttt
aatgggaaggagttatgcaagaatatcaaccctgacgaggcagtggcttatggggctgct
gtgcaggctgccattttgagtggcgagggtaatgagaaggtgcaggatcttcttctgttg
gatgttacccccctgtcccttggactggagactgcaggaggtgtcatgactgtcttaatt
ccaagaaacacaaccattcccaccaagaaggagcaggtcttctctacttactctgacaac
cagcctggtgtgctgattcaagtttatgaaggtgaaagggccaggaccagggacaacaac
ctccttggtaaatttgagctctccggcattcctccagctccaaggggtgttcctcagatt
acggtttgctttgacattgatgccaatggtatcctgaacgtctctgctgaggacaagacc
accggacaaaagaacaagatcaccatcaccaacgacaagggtaggttgagcaaggaggag
atcgagaagatggtccaagatgcagagaagtataagtctgaggatgaggagcacaagaaa
aaggtggaggctaagaatgccttggaaaattatgcctacaacatgaggaacactgtcaag
gatgataagatttcatccaagctgactgccgaagacaagaagaagatcgaggacgccatt
gagcaggctatccaatggcttgacgggaaccagttggccgaggctgatgagttcgaggat
aaaatgaaggagctggaaagcatctgcaaccccattattgccaagatgtaccagggtgct
ggtgccgacatgggtgctggaatgaatgatgatgctccctcggctggcggcagtgggtct
ggccccaagattgaggaggtcgattaa

DBGET integrated database retrieval system