KEGG   Elaeis guineensis (African oil palm): 105046449Help
Entry
105046449         CDS       T03921                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00020  Citrate cycle (TCA cycle)
egu00640  Propanoate metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105046449
   00640 Propanoate metabolism
    105046449
Enzymes [BR:egu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     105046449
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     105046449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 105046449
NCBI-ProteinID: XP_010923343
Position
6
AA seq 340 aa AA seqDB search
MSRQAAKLVGSLASKLVSQPKLSASSPLASQSRRHFGAAPPPAPAVFVDKNTRIICQGIT
GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAEAKANASVIYVPPPF
AAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKIG
IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRFL
DDPQTEGIVLIGEIGGTAEEDAAALIRESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGG
KGTAQDKIKTLREAGVTVVESPAKIGVAMLDVFKQHGLVD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccaggccgcgaagctggtcggatccctcgcctccaagctcgtatcccagccc
aagctctccgcctcctctcctctagcctcccaatcccgccgccacttcggggcggcgccg
cccccggcgcccgccgtcttcgtggacaagaacacccgcatcatatgccaggggatcacc
ggcaagaacggcaccttccataccgagcaagccatcgagtatggcaccaagatggttggt
ggagtcacaccaaagaaaggtggaactgaacacttgggtcttccagtgtttaacacagta
gcagaagcaaaggccgaggcaaaagctaatgcatcagttatatatgttcctccgcctttt
gctgctgctgcaatactggaggcacttgaagctgaattagatcttgttgtgtgcattacc
gaaggaattccccagcatgacatggttcgggtgaaggctgctcttaaccagcaatcaaaa
actcgacttattggaccaaactgtcctggcattatcaagcctggagaatgtaaaatcgga
ataatgcccggttatatccacaagccagggcgtatagggattgtatctcgatctggtacc
ttaacttatgaagcggtttttcagacaaccgctgttggtctaggacagtcaacttgtgta
ggtattgggggtgaccccttcaatgggacaaattttgttgattgtgtaaccaggttcctt
gatgatcctcaaactgaaggtatcgttcttatcggagagattggtggtactgcagaagag
gatgctgcagctttaatacgggaaagtggaactgagaagcctattgttgcatttattgct
ggacttacagcaccgccaggtcgtcgcatgggtcatgcaggagcaattgtgtcaggtggt
aagggtactgcacaggacaaaatcaagaccctcagagaagcaggcgtaacagtggttgag
tccccagccaagattggtgttgctatgcttgatgttttcaaacaacatggactagtggat
tag

DBGET integrated database retrieval system