KEGG   Elaeis guineensis (African oil palm): 105046779Help
Entry
105046779         CDS       T03921                                 

Definition
(RefSeq) probable glutathione S-transferase parA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00480  Glutathione metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105046779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egu02000]
    105046779
Enzymes [BR:egu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105046779
Transporters [BR:egu02000]
 Other transporters
  Pores ion channels [TC:1]
   105046779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_5 GST_C_6 GST_C_3 GP46
Motif
Other DBs
NCBI-GeneID: 105046779
NCBI-ProteinID: XP_010923799
Position
6
AA seq 221 aa AA seqDB search
MATAEKGVVLLDAWVSPFGQRCRIALAEKAVEYEYSEQNLADKSPLLLKVNPIHKKIPVL
IHDGKPVCESLIIVQYIDEVWTKNPLLPSDPYERAKARFWADFVDKKVYECGTKLWKLKG
EAQQEAKKEMIEILKLLEGELGDKKYFGGEIFGFVDVALVPFTAWFYAYETCANFSVEAE
CPKLVAWSKGCMERESVAKSLHDPHKVYEFVCFLKKKFGME
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcggagaagggggtggtgctgcttgacgcgtgggtgagtccgttcgggcag
cgatgccggatcgcgctggcggagaaggcggtggagtacgagtacagcgagcagaatctt
gccgacaagagcccgctgctgctgaaggtgaaccccatccacaagaagatcccggtgctc
atccacgacggcaaacccgtctgtgagtccctcatcatcgtccagtacatcgacgaggtc
tggaccaaaaaccccctcctcccctccgatccctacgaacgcgccaaggcccgcttctgg
gccgacttcgtcgacaagaaggtctatgaatgtgggacaaagctgtggaagctcaagggg
gaggcacaacaggaggccaagaaggaaatgattgagatattgaagcttttggagggtgag
ctgggagacaagaagtactttgggggagagatttttggctttgtggatgtagcattggtg
cccttcacagcctggttctacgcctacgagacctgcgccaacttcagcgttgaggcggag
tgccctaagctggtggcctggagcaaggggtgcatggagagggagagcgtggccaagtcc
cttcatgatccccataaggtctacgagttcgtatgcttcctcaagaagaagtttggaatg
gagtaa

DBGET integrated database retrieval system