KEGG   Elaeis guineensis (African oil palm): 105048650Help
Entry
105048650         CDS       T03921                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105048650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:egu03041]
    105048650
Enzymes [BR:egu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105048650
Spliceosome [BR:egu03041]
 Complex C
  Other components
   Step II factors
    105048650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind IBR HA2 zf-C3HC4_2 zf-RING_UBOX DEAD zf-C3HC4 zf-RING_2 zf-C3HC4_4 AAA_22 zf-RING_5 AAA_30 AAA_19 Helicase_RecD ABC_tran ABC_tran_CTD
Motif
Other DBs
NCBI-GeneID: 105048650
NCBI-ProteinID: XP_010926340
Position
7
AA seq 1736 aa AA seqDB search
MRRGGYPDRCLGRPPFRPERPLFRQERLPFRPQPQAYHRHWQQPPAPRPRFVVVLVCSPS
TQKGLSSSYIRDLLVSCPSTPENFFYSQGAVVGKFIFRCWADALEASVYLWGRRLDGAHH
LTAKIESSTGLLPSLKAEEESRLRALFTGHIRGLLECEAVRRCEGKIEQVEHEIKKVSGK
LTKPIRLATIGKIQDTRKSLEAEKEQLESRLKEFRAAMECLIAYLSEQQEVCEEEEGKVE
IFKLQGELDWSRIHHLMERECRRFEDGLPLYACRRKILSHIFSNQVLVLIGETGSGKSTQ
LVQYLADAGLAADGSILCTQPRKIAAISLAQRVGEESNGCYADNFVISHPTYSSFQKFNS
RLIFMTDHCLLQHCMNDMSLSGISYIIVDEAHERSLNTDLLLALIKKKLLERLDLRLIIM
SATADAGKLAEYFYGCYTLYVKGRNFPVEIKYIPDISAPTICTTTLTHTSGIYASYVGDV
IKMVRIIHKTETDGSILAFLTSQMEVEWACENFHDPSAVVLPMHGKLSYEEQSRVFQKYP
GKRKVIFSTNVAETSLTIQDVKYVVDSGMVKESRYEPGNGMNVLKVGRISQSSASQRAGR
AGRTAPGKCYRLYSECDFYSMKTHPEPEIRKVHLGIAVLRILALGIKNVQDFEFVDAPSP
QAIDIAMQNLVQLGAVTNNADVFKLTDTGWSLVKLGIEPRLGKIILDCFGRGLRKEGLVL
AAVMANASSIFCRVGSDEDKYKADRLKVPFCHRYGDLFTLLSVYKKWEDKRENKNKWCWQ
NSINAKSMRRCQETVVELENCLQHELNIIIPNYWLWDPDKPNLHDQILKKIILSSLAENV
AMFSGCDRVGYEVALTGQLVQLHPSSSLLMFSQKPNWVVFGEILSISNQYLVCVTAVDSE
SLCVIQPPLFDIQQLESRRMQMNVIPGVGSNLLKRFCGKHNQNLQRIISHIQKVCMDDRI
GIDVDFGKSEIQVFASPKDMEKACCIVNDALEYETKWLRDECVEKYLFPGRPGSSLPVAL
FGSGAEIKHLELEKRHLTVEISHPNAHAVDDKEVLLMVDQCVSGIANYHKYAGNGPEGTD
KWGKITFLSPAAAENAVAKLNEVEFHGSLLKALPVRAVDNKLLPFSAVRARVCWPRRPSK
GAALITCAGGEAEFIVRDCFALVVGGRYVNCQVSTKYKNCVFVTGLPRDVSETELYDAFL
SSTERKILDIHLLRGEPIPNPPGATCREALVREISAFMPKKNFRDHSFQIEVFNPEPKDY
MMKAIITFDGGLHLEAAKALDHIQGKVLPGCLSWQKIRCEHVFHSHLSCPARVYFVIKKQ
LDSLLESFQQQKGVSYNLEKNDNGSCRVKISANATKTIADLRRPLEQLMKGKTISHPSLT
PTVLQLLFSRDGVALLKAVERKSGTYILYDRQNLNVKVFGPPKEVAAAEQNLVQSLLSLH
EDRQLEIRLRGRNIPPNLMKEVVQRFGPDLQGLKEMVPGAELTLNTRSHIINVRGNNELK
RRVEEVISEVALSVDHAWMIKQPSGTSCPICLCELEEPYRLEACGHDFCRSCLVDQLEST
IRSRDSFPIGCTKEGCNELILLVDLRSLLPSEKMEELFRASLGAFVASRGGAYRFCPSPD
CPSVYQVAPKDAEAGHFVCGACSVETCTKCHLEYHPFISCERYKEYKEDPDLSLVEWRKG
KEYIKDCPACGYTIEKIDGCNHIECKCGRHICWVCLEFFRSSDECYGHLRSEHQYY
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggggcggctaccccgatcgttgcctggggcggccgccgttccggccggagaga
ccgcttttccggcaagaacggctgcccttccgcccccaacctcaggcctaccataggcac
tggcaacagccgccggcgcctcggccccgcttcgtcgttgtcctagtctgttccccttcc
acccagaaaggcctctcctcgtcgtacatccgcgacctcctcgtctcctgcccttccacg
ccagagaacttcttctactcccagggcgccgtcgtcggaaagttcatatttcggtgctgg
gccgatgccctcgaggccagcgtctacctctggggccgccgactggacggcgcccaccac
ctgaccgccaaaatcgagtcctccaccggtctcctcccatctctaaaggccgaggaggag
agccgcctcagggccctcttcaccggtcacatccggggccttctcgagtgcgaggcggtc
cggcggtgtgaagggaagatcgagcaggtggagcatgaaatcaagaaagtgtcggggaag
ctcacgaagccgattcggctggccaccattgggaagattcaggacactaggaagagtctg
gaggcagagaaggagcagttggagagcaggttgaaggagttcagggccgccatggagtgt
cttattgcttacctcagtgagcagcaggaggtctgtgaggaggaggaggggaaagtcgag
atttttaagcttcaaggtgaattggattggagcaggatccaccatttgatggaaagggaa
tgccgccggttcgaggatgggttgcccctctatgcttgcagaaggaaaattcttagccac
atattctccaatcaggttttggttttgattggggagactggttctggaaagagtacccag
ttggtccaatatcttgccgatgcaggactagctgctgatggatcaattttgtgtactcag
cctcgaaaaattgcagcgatatctttggcacaaagggttggggaggaaagcaatgggtgc
tatgcagacaatttcgtgatttctcatcccacctattcatcctttcagaaattcaattct
cggttaatatttatgactgaccattgtctcctgcaacattgcatgaatgatatgagtttg
tctggtatatcatatatcattgtagatgaagctcatgaaagaagcttgaacactgatctt
cttttggcattgattaagaagaaactacttgagagattagatctacggcttataataatg
tccgcgactgctgatgcaggcaaacttgcagaatatttctatggttgctacaccttgtat
gtcaaggggagaaactttcctgttgaaataaaatatattcctgatatatctgcccccact
atctgtaccaccactttgacgcacacttctggtatttatgcttcctatgttggtgatgta
ataaagatggtgcgcataattcacaagacggagacagatggttccatccttgcatttcta
acttctcaaatggaagtagaatgggcttgtgagaattttcatgatccctctgcagtggtg
ctgccgatgcatgggaaactttcttatgaggaacaaagtcgtgttttccaaaaataccca
ggaaagagaaaagttattttttccactaatgtagctgagacttctcttaccatccaagat
gttaagtatgtggttgactctggcatggtgaaggagagcaggtatgagcctggcaatggc
atgaacgtgctcaaggttggcaggataagtcaaagttctgctagtcaacgagcaggtcgt
gcaggtcgaacagcaccgggcaagtgttacaggctttactcagaatgtgatttctattca
atgaaaacgcatccggaacctgaaattcgcaaggttcaccttggaattgctgttctgaga
attcttgctttgggcattaagaacgtgcaggattttgagtttgttgatgctcccagtccg
caggcaattgacatagctatgcagaatcttgtccagttgggtgctgttaccaacaatgct
gatgtctttaaacttactgatactggctggtctttagtgaaattgggtattgaaccacgg
ctggggaaaattattcttgattgctttggccgtggtttgagaaaggagggccttgttctt
gctgctgtaatggcaaatgctagcagcatattttgtagagttggcagtgacgaggataaa
tataaagcagaccgtcttaaagttccattctgccaccgttatggggaccttttcacactg
ctctctgtttacaagaaatgggaagataaacgtgaaaataagaataagtggtgttggcag
aatagcatcaatgctaagtcaatgagaaggtgtcaggagactgtagtggaattggaaaat
tgtcttcaacatgaactcaacattatcattccaaattactggttatgggatccagataag
cccaatttgcatgatcaaatattgaagaagattatactttcatcccttgcagagaatgta
gctatgttttctggatgtgatcgagttggttatgaagtggctctgacaggtcaacttgtg
caacttcatccatcgagttcattgctcatgtttagccagaaaccaaactgggtagttttt
ggggaaattttatcaatatcaaatcaatatttggtttgtgtaactgcagtggactctgaa
agcttgtgtgtgatccagcctcctctgtttgatattcaacagttggagagccggaggatg
cagatgaatgtgatccctggagttggcagtaatctgcttaaaaggttttgtggcaaacac
aatcaaaacctacagaggattatttcgcatatccagaaagtttgcatggatgaccgtatt
ggtattgatgttgacttcggaaaaagtgaaattcaggtatttgcatcaccaaaagatatg
gagaaggcttgttgcatcgtcaatgatgccttggagtatgaaacaaaatggttgagggat
gagtgtgttgagaaatacttatttcctggcaggcctggtagttctctcccagtggcactg
tttggctcaggtgctgaaattaagcatctagaacttgaaaagagacatctaactgtggaa
atatcccatccaaatgctcatgctgtagatgataaggaagttcttttgatggttgaccaa
tgtgtgtctggaatagctaactatcataaatatgcaggaaatggaccagagggaacagat
aaatggggcaagataacatttcttagtcctgcggctgcagaaaatgctgttgccaagctg
aatgaggtagagtttcatggttccctgttgaaagctcttcctgtaagggcagttgacaat
aagctgcttccattttctgcagttagagccagagtttgttggcctcggaggccaagcaaa
ggagctgcacttattacatgtgctggaggagaggctgaatttattgtcagagactgcttt
gcgttggtggttggaggtaggtatgttaactgtcaggtcagcacaaaatacaaaaattgt
gtatttgtaacaggactgccaagagatgtatcagaaacagaattatatgatgctttttta
agttcaacagagaggaaaatccttgacattcacttgttgagaggagaaccaatacccaac
cccccaggtgctacttgtagagaagcacttgttagagaaatttctgcttttatgcctaaa
aagaattttcgtgaccatagtttccagattgaagtgttcaacccggaaccaaaggattat
atgatgaaagctataatcacatttgatggcggccttcaccttgaggcagcaaaggctttg
gatcacatccaggggaaggtactacctggttgtctctcatggcagaagatacggtgcgaa
catgtgtttcacagccatctatcttgtccagctcgtgtctattttgtcattaagaaacaa
ctggattctttacttgaaagcttccagcagcagaagggtgtatcctataatctggaaaag
aatgataatggttcttgtcgagtgaagatatctgccaatgccacaaaaactatcgcagat
ttgaggaggcctctcgagcagttgatgaaaggcaagaccataagccatccaagcctcact
ccaaccgtgcttcagttactcttctcccgggatggagtggccctcttgaaagctgtggag
cggaagtctggaacttacattctgtatgaccggcagaacctaaatgttaaagtgtttgga
cctccgaaggaggttgctgcagctgagcagaatttggtgcaatcactgctatccctccac
gaggacaggcaactcgaaatccgtctccggggtcgcaacatccccccaaacttgatgaaa
gaagtggttcagagatttggaccagatcttcaggggctgaaggaaatggtgcctggggcc
gagctgaccctcaacacccgatcccatataatcaatgttcgaggaaacaacgagctgaag
cgaagggtggaagaggtgatctctgaggtggcactatctgttgatcatgcttggatgatc
aagcagccgtcgggaacctcttgccccatttgcctgtgcgagctggaggagccttacagg
cttgaagcctgtgggcatgatttctgtcggagctgcttggttgatcaattggagtccacc
atcaggtccagagatagcttccctatcggttgcaccaaggagggttgcaatgagctcatc
ctgctcgtggacctgcggtctcttctgccgtctgaaaagatggaagagctcttcagggcc
tctttaggtgccttcgtggcttccaggggcggggcctaccgcttctgcccctcacccgat
tgcccgtctgtgtatcaggttgcccccaaggatgcagaggctggacattttgtttgtggg
gcttgctcggtggagacatgcaccaagtgccatcttgagtaccatcctttcatatcttgt
gagagatacaaggagtacaaggaggacccggacctgtcgctagtggagtggcgcaagggg
aaggagtacataaaggactgccccgcctgtggttacacaattgagaagatcgatggttgc
aaccacatcgagtgcaagtgtgggagacacatttgttgggtgtgcttggagttcttcaga
agcagtgatgagtgctatggtcatcttaggtctgagcaccagtactactga

DBGET integrated database retrieval system