KEGG   Elaeis guineensis (African oil palm): 105050196Help
Entry
105050196         CDS       T03921                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: calcium/calmodulin-regulated receptor-like kinase 1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egu01001]
    105050196
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105050196
Protein kinases [BR:egu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   105050196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 105050196
NCBI-ProteinID: XP_019705974
Position
1
AA seq 303 aa AA seqDB search
MSTGETVAVKVLSANSKQGEKEFHTEVMLLGRLHHRNLINLLGYCADEGQHMLMYVYMSN
GSVASHLYGEKHGPLSWNLRVNIALDVARGLEYLHDCAVPSVVHCDIKSSNVLLDQFMRA
RVVDCGLSREAVFSCHISNVRGTFGYLDPDYVSSRTFTKKSDVYSFGVLLFEMIAGRKPQ
LGLMEYVELAAINTEGRVDWEELGFVDSXLAGVYDVQEVNDMVAIVYTCVSLVSKKLPPM
SYAVQALSCIVKANLRKRHHERKLLLTNVQNESMDXELPDVLTSISRLLSEESIGSSSDL
SDV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggggagacagttgctgttaaagtgctttctgccaattctaagcaaggggag
aaggagtttcatactgaggttatgctacttggtagattgcatcatagaaaccttataaat
ttgctggggtactgtgcagatgaaggccagcatatgctaatgtatgtctacatgagtaat
ggcagtgttgcttctcacttatatggtgagaaacatggaccattgagctggaacttgagg
gttaatatagctctagatgttgcaagaggcttggagtatcttcatgactgtgctgttcca
tctgtagtgcattgtgacatcaagtcttctaatgtactattggatcagttcatgcgagct
agagttgtggattgtgggctatctagagaagcagtgtttagctgtcacatatctaatgtc
aggggaacttttggctatcttgatcctgattatgtatcatcaaggactttcaccaagaaa
agtgatgtctacagcttcggtgtcctgctttttgaaatgattgcaggtaggaagccacaa
ctgggccttatggagtatgtcgagcttgcagcaataaataccgagggaagagttgactgg
gaagaactaggattcgtggattcttagctagctggagtatatgatgtgcaagaggtaaat
gacatggtagcaattgtatacacatgcgtcagcctagtttctaaaaaactgcctcccatg
agttatgcggttcaggctctgtcatgtattgtgaaggcaaaccttagaaaaaggcatcat
gaaaggaaactcctgctgaccaatgtacagaatgagtccatggactaagaactgccagat
gttcttacttcaatttccaggcttctgagtgaggagtccatcggtagctcgtctgacctg
tcagatgtttaa

DBGET integrated database retrieval system