KEGG   Elaeis guineensis (African oil palm): 105052739Help
Entry
105052739         CDS       T03921                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00061  Fatty acid biosynthesis
egu00071  Fatty acid degradation
egu01100  Metabolic pathways
egu01212  Fatty acid metabolism
egu04146  Peroxisome
Module
egu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105052739
   00071 Fatty acid degradation
    105052739
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105052739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:egu01004]
    105052739
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egu04147]
    105052739
Enzymes [BR:egu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     105052739
Lipid biosynthesis proteins [BR:egu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   105052739
Exosome [BR:egu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105052739
  Exosomal proteins of breast cancer cells
   105052739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 105052739
NCBI-ProteinID: XP_010931974
Position
10
AA seq 722 aa AA seqDB search
MNEAWARHNKEERHAMDSSAARRRLRAISGHLRPAGDRDCDRYSQLGTNATACEFVSEQG
YSVVLPEKLQTGKWNVYRSARSPLKLVTRFPEHPDIGTLHDNFEYAVETFRDYKYLGTRV
RVDGTVGEYKWMTYGEAGTSRSAIGSGLVYRGIPKGACVGLYFINRPEWIIVDHACSAYS
YISVPLYDTLGPDAVQYIVNHAAVQVIFCVPQTLSILLSFLSQIHCVRLIVVVGGIDDNM
PSVPSTTGVEIITYSKLHNQGHSNLQPFRPPKPEDVATLCYTSGTTGTPKGAVLTHENLI
ANVAGASLSTKFCPSDVYISYLPLAHIYERANQISLAHFGAAVGFYQGDNLKLMDDIAAL
RPTIFASVPRLYNRIYAGIVNAVKTSGGLRERLFNAAYNAKKRAIANGKNPYPMWDKLVF
NKIKEKLGGRVRIMTSGASPLSSDVMDFLRICFGGMILEGYGMTETACVISAMDEGDLLT
GHVGSPNPACEIKLVDVPEMSYTSDDQPYPRGEICVRGPIIFQGYYKDDVQTKEVIDENG
WLHTGDIGMWLPGGRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCNFISQCFVYGDSLN
SCLVAIVSVEPDVLKAWAASEGIKFLKTKATPSKPSDMYEDLRELCADSRAKAAVLAEMD
DVGKQAQLRGFEFAKAVTLTLEPFTLENGLLTPTFKVKRPQAKAYFAKEIADMYAKLSAS
NP
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcgtgggcgaggcataacaaggaagaaaggcacgccatggactcctccgct
gctcgacgccgtctgagagccatctccggccatctgcggccggccggcgatcgcgattgt
gaccggtactcccagctcggcacaaacgccaccgcctgcgagtttgtctctgagcagggc
tacagtgttgttcttcctgaaaagttgcaaactgggaagtggaatgtatacagatctgca
cgctcacctttgaagctagtgactagattcccagagcatcctgatattggaacattacat
gataactttgagtatgcagttgaaactttccgagattacaagtatttggggacaagggtt
cgtgtcgatggaacggttggagaatacaaatggatgacctatggagaagccggtacttcc
aggtcggcaataggttccggcctcgtatatcgtggtatacccaaaggtgcatgtgttgga
ctatatttcattaacagaccagagtggattatcgtggaccatgcttgctcagcatactct
tacatatctgtgccactttacgatacccttggaccggatgctgttcagtatattgtgaat
catgctgctgtacaggttattttttgtgtgccacaaacactaagcattttattaagtttc
ttatctcagattcattgtgtacgtctaatagtggtggtaggcgggattgatgacaacatg
ccatcagttccttcaacaactggtgtggagattattacttactcaaaactacacaatcaa
ggtcatagcaatcttcaaccatttcgccctcctaaacctgaagatgttgcgaccttatgc
tatacaagtggtacaacaggcacaccaaagggagctgtattgactcatgagaacttgatt
gcaaatgttgctggagctagcctaagtaccaaattttgtccttcagatgtctatatatcc
tatcttcctttggcacacatctatgagcgggccaaccaaatctcattggcacattttggt
gctgcggttggattctatcaaggggacaatttgaaattaatggatgacattgcagctctg
agacccacaatatttgccagtgttcctcgattgtacaacagaatatatgctggaattgta
aatgctgtaaagacgtctgggggtttaagggagagattattcaatgctgcctacaatgcc
aagaagcgagcaatagcaaatggcaagaatccatatccaatgtgggataaactagttttt
aacaaaataaaagagaaacttggaggacgggtccggattatgacttcaggtgcctctcca
ttgtcatcagatgtcatggattttttgagaatatgttttggtggcatgattttagaaggt
tacggaatgactgagacagcttgtgtcataagtgcaatggatgaaggtgacctgcttact
ggtcatgttggctctccaaatcctgcttgtgagatcaaacttgtagatgttcctgaaatg
agctacacatctgatgaccaaccatatccacgtggagaaatttgtgtcagaggccctata
atttttcaaggctattacaaagatgatgtgcagacgaaagaggtaattgatgaaaatggc
tggctgcataccggagacatagggatgtggttgcctggaggacgtctaaagatcatagac
aggaaaaagaacatttttaagttggcccagggcgagtacatagccccagagaagatcgag
aatgtttatgctaagtgcaacttcatttctcaatgttttgtctatggtgacagcttaaac
tcttgtctggttgcaatagtctcagttgagccagatgtattgaaggcttgggccgcatct
gaaggaatcaagtttttgaaaacaaaagcaacgccaagcaagccctcggatatgtatgaa
gatcttagagaactatgtgctgattcaagagcaaaggctgctgtccttgccgagatggat
gatgttggaaagcaggctcagctgagaggttttgaatttgccaaagctgttactttgaca
ttagaaccattcactttggaaaatggtcttcttactccaacattcaaggttaagagacct
caagcaaaggcttattttgcaaaggaaattgcagatatgtatgctaagttatctgcatct
aatccttga

DBGET integrated database retrieval system