KEGG   Elaeis guineensis (African oil palm): 105054034Help
Entry
105054034         CDS       T03921                                 

Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00052  Galactose metabolism
egu00500  Starch and sucrose metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105054034
   00500 Starch and sucrose metabolism
    105054034
Enzymes [BR:egu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105054034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 105054034
NCBI-ProteinID: XP_010933713
Position
11
AA seq 644 aa AA seqDB search
MDVPDLKSPIFIPDSYSPSQQVDDSSIPTSSPGPPRRYLMLVLFAVSAVSLLGLVSPFYH
GGELASHRAPATPLERWTLSRGTAEGVSEKSNGRILGATPVYPWTNAMLVWQRTAYHFQP
QKNWMNDPDGPMYYKGWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPLAMVPSHWY
DANGVWTGSATLLPDGRIAMVYTGSTTESVQVQNLAFPADPDDPLLLKWNKSESNPVIRP
PSWIGLTDFRDPTTAWYVPTESAWRIAIGSKDADHNGIALVYRTKDFVTYELLPRLLHSV
NRTGMWECVDFYPVSTASKVGLDTSTGPGPGVKHVLKASLDDNKHDYYAIGTYDGEEGTW
TPDDQEMDVGIGLRYDYGKYYASKTFYDPVKERRVLWGWSGETDSEKTDLLKGWASVQTI
PRTVTYDDKTGRNLLQWPVDEVEKLRQSSQEFSNITLGVGSVAPLDISKATQLDIEAKFE
IDASALERAIEADVGYNCSTSGGAAGRGALGPFGLLVLADQDLSEQTAVYFYLGRGTDGG
FGTFFCQDELRSSLANDLVKRVYGSSVPVLDGESLTVRILVDHSIVESFAQGGRTCITSR
VYPTEAIYGGARVFLFNNATGAPVTAKSIKIWQMNSAFIHPYAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcccggatctcaagtcccccatcttcatcccagattcctattctccttcccaa
caagtcgatgattcctccattcccacctcctctcctggacctccgaggaggtacttgatg
ttagtcttgttcgccgtctcagctgtatcattgctgggcctcgtctctccgttttaccat
ggaggagaattggcgtcccaccgggcaccggcgactccattggaacgatggaccttgtcc
cggggcacggccgagggcgtgtcggagaagtccaatggacggatcctcggcgccaccccg
gtctacccctggaccaacgccatgcttgtctggcagcgcacggcctaccatttccagccg
cagaagaactggatgaatgaccctgatgggcccatgtattacaaggggtggtatcacctg
ttctaccagtacaacccggactcggcggtgtgggggaacatcacgtgggggcacgccgtg
tcacgtgacctcatccactggctctaccttcccctcgccatggtccccagccactggtac
gacgccaacggcgtctggaccggctccgcgacgctcttgccggacggccggatcgccatg
gtctacaccggttcgaccaccgagtcggtccaggtccagaacctcgccttcccggccgac
ccggacgacccgctccttctcaagtggaacaagtcggagtccaacccggtaatccgtccc
ccttcctggatcgggctgaccgacttccgcgacccgaccacggcctggtacgtgccgacc
gagtcggcctggcggatcgccatcggatcgaaggacgcggaccacaacggaatcgcgctg
gtgtaccggaccaaggacttcgtaacctacgagctcctccccaggctgttgcactcagtg
aaccggaccgggatgtgggagtgcgtggacttctacccggtgtcgaccgcgtcgaaggtg
gggctggacacgtcgaccgggccggggccgggcgtgaagcacgtgctgaaggcgagcctg
gacgacaacaagcacgactactacgcgatcgggacgtacgacggggaggaggggacgtgg
acgccggacgaccaagagatggacgtggggatcgggctgaggtacgattacggcaaatac
tacgcgtcgaagacgttctacgacccggtgaaggagcggcgcgtgctgtggggttggagc
ggggagaccgacagcgagaagacggacctcctcaagggctgggcctccgtacagaccatt
ccaaggacagtaacctatgatgataaaacgggaagaaacctactccagtggccagtcgac
gaggtagagaaactaagacagagcagccaagagttcagcaacatcacacttggcgtcgga
tcagtagcgccattggacatcagcaaagccacacagttggacatcgaggccaagttcgag
atagatgcgtcggccttggaacgggctatcgaggccgacgtggggtacaactgcagcaca
agcggtggtgccgctgggcgtggtgcattgggaccttttggattgctcgtgttggccgac
caggacctaagtgagcagactgcagtgtatttttaccttgggagggggacggatggcggc
tttggtactttcttctgccaggatgagttgaggtcgtcattggcaaatgaccttgtcaag
agggtttacggtagctcggttcctgtgctcgatggtgaaagcttgacagtgaggattctg
gtggatcactccatagtagagagctttgctcaaggggggaggacatgcatcacatcgcgt
gtgtatccaactgaagcaatttatggcggggcacgagtcttcctcttcaacaatgcaacc
ggcgctccggtgaccgccaaatcgattaagatatggcagatgaattctgcattcattcat
ccatacgcggcctag

DBGET integrated database retrieval system