KEGG   Elaeis guineensis (African oil palm): 105054147Help
Entry
105054147         CDS       T03921                                 

Definition
(RefSeq) arogenate dehydratase 3, chloroplastic
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    105054147
Enzymes [BR:egu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     105054147
    4.2.1.91  arogenate dehydratase
     105054147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 105054147
NCBI-ProteinID: XP_010933891
Position
11
AA seq 356 aa AA seqDB search
MASSAPPLKFPNSLFPSTKKRGELLDLPSITPVGKSWKPSTVVLAGINGHPQINGSGGLR
VAFQGAPGAYSEFAAKTACPACTTIPCRAFADAIAAVERGRADRAILPVESTMEGTALRN
YDLLLRHDLRIVQEINLFVHYCLLAMPGVRPGELRRVISHPMALAHCGRALSQLGLLREP
VEDTAGAVEMLRSNHLLDTAAIASPRAAVLYGLDVLAHGLQDESWNVTRFLLLSKTATRP
PQKPAGAGLKTSLVVAHRGGSMMVLLKVLSAFSKRNINLTKLEVINSSNEGEAPVMILDV
RGKGSLRAFPHVLYVDFEGSTDESKVKEAIDEISSFSVFVRILGSYVADHNVYDLQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctgctccccctctaaaatttccgaactctttattcccgtctacaaaaaag
agaggcgagcttttagatttaccctctattactccagtcggcaagagttggaagccctcg
acggtggtcctcgccggcatcaatgggcacccccagatcaacggctccggcggcctccgc
gtggccttccagggtgccccgggcgcctacagcgagttcgcggccaagacggcgtgcccg
gcctgcaccaccatcccgtgccgcgctttcgccgacgcgatcgctgccgtggaacgaggc
cgcgccgaccgcgccatcctccccgtggagagcaccatggagggcaccgccctccgcaac
tacgacctcctcctccgccacgacctccgcatcgtccaggagatcaacctcttcgtccac
tactgcctcctcgccatgcccggcgtccgccccggcgagctccgccgcgtcatcagccat
cccatggccctcgcccactgcggccgcgccctttcccagctcggcctcctccgcgagccc
gtcgaggacaccgccggcgccgtcgagatgctccgctccaaccacctgctcgacaccgcc
gccattgcgagcccccgtgccgccgtcctctacggcctcgacgtcctagcgcatgggctc
caggacgagtcctggaacgtcacccgcttcctcctcctgtcgaagaccgccaccagacca
ccccagaaaccggccggtgccgggctgaagacgagcctggtcgtcgcccaccggggcggg
tccatgatggttctgctaaaagtcctctcggcattctcgaaacgaaacatcaatctgacg
aagctggaggtgatcaattcgtcgaacgaaggggaggcgccggtgatgatactggacgtg
agggggaaggggtcgctgagggctttcccccatgttttgtacgtagatttcgagggctcc
acggatgagtccaaggtaaaggaagccatcgatgagatctcttctttttcggtttttgtt
cgtattcttggcagctacgtggccgatcataatgtttatgatcttcaatag

DBGET integrated database retrieval system