KEGG   Elaeis guineensis (African oil palm): 105054921Help
Entry
105054921         CDS       T03921                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egu01001]
    105054921
   01009 Protein phosphatases and associated proteins [BR:egu01009]
    105054921
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105054921
Protein kinases [BR:egu01001]
 Serine/threonine kinases: Other
  Wnk family
   105054921
Protein phosphatases and associated proteins [BR:egu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105054921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 105054921
NCBI-ProteinID: XP_019710571
Position
1
AA seq 627 aa AA seqDB search
MKFYTSWVDTSKRNINFVTEMFTSGTLRQYRQKHRRVNIRAVKHWCRQILRGLLYLHSHD
PPIIHRDLKCDNIFINGNQGEVKIGDLGLAAILRKSHAVHCVGTPEFMAPEVYEEEYNEL
VDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISGTKPEALYRVKDPEVRQFVEKCLAT
ASRRLPARELLQDPFLQSNDRGVVYEEGELSIVGHIMKQPSLDLLPSNGLLYANGFSDGL
HQEIENGWDYHAADIENHGMDLFNGQEDDPPANVDITIKGRKREDGSIFLRLRIADKDGR
VRNIYFPFDVEADTALSVATEMVAELDITDYEVTRIAEMIDGEVASLVPEWKIGPWMEEM
PGVPTTTFCQNCASNVSSYDSLIDYLSLKSPCCANAQSIHCSNLECAAMHGRFEEITYQV
EGSEHTVTEGPWMLSTSQSNVPDCCSQATRENYSDDEDDQSVKDERNKHMNGYLHSGTRK
SLGHRYSSSDQQCCLEVTELTCDFPPDKSNDYENEICQELRCLDPRYQTELREYETRHLQ
ESRRALHPSPELGNRKMRVESGTAGSLVKPSQTSDDKLMKSFHLGTHFSFRIPHGDTDPI
LTKKSFPADTNAGYCWSSRPNLGSQRA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctacacctcctgggttgacacctccaagaggaacatcaattttgtcactgag
atgttcacctctggcactctcaggcagtacaggcagaagcatagaagggttaacatcagg
gcggtgaagcattggtgcaggcagatcctgaggggtctcctctacctccacagccatgac
ccccccatcatccacagggacctcaagtgtgacaacatcttcatcaatgggaaccaagga
gaggtcaagatcggcgacctcggcctcgccgccatcctccggaaatcacacgccgtccat
tgcgtaggcacaccggaattcatggccccagaggtgtatgaagaggaatacaatgaattg
gtggacatttattcttttgggatgtgcatcttggaaatggtcaccttcgagtacccgtac
agcgaatgcacgcatccggcgcagatctacaagaaagttatctctgggaccaagcctgaa
gctttgtatagagttaaggatcctgaggtgaggcaatttgtggaaaaatgcttggccacg
gcttcccgaaggcttcctgctagagagcttctacaggacccatttctccaaagtaatgat
cgtggtgtggtatatgaagagggagaattgagcattgtgggccatatcatgaagcaacct
tctcttgatcttcttccaagtaatggtttgttgtacgctaatggattctctgacggtctc
catcaggaaatagaaaatggatgggactaccatgctgctgacatagaaaaccatggaatg
gaccttttcaacggccaagaagatgatccccctgctaatgtggatatcacgatcaaggga
aggaagagagaagatgggagcatttttttgaggctcaggattgcagataaagatggccgt
gtgcgtaacatatacttcccgtttgacgtcgaagccgatactgcattgagtgttgcaacg
gagatggtcgcagagttagatataactgattatgaagtgactagaatagcagaaatgatc
gatggagaggtagcatcgctggtaccggaatggaagataggaccttggatggaggaaatg
ccaggagttcctactacaactttctgtcagaattgtgcatccaatgtctcatcatatgat
tcacttatagactacctttcactcaagagtccatgctgtgctaatgcgcagtcaattcat
tgttccaaccttgagtgtgctgcaatgcatgggcggttcgaagagataacatatcaagtt
gagggatctgagcacactgtgaccgaggggccatggatgctatctaccagccaatcaaat
gtgcccgactgttgctcacaagctacaagagagaattactcggatgatgaagatgaccaa
tcagtcaaggatgagagaaacaaacacatgaatggctatctgcatagcggcactagaaaa
tcattgggtcatcggtactctagttctgaccaacagtgttgcctggaggtaacagaatta
acatgcgactttccacctgataaatccaatgattacgaaaatgagatctgtcaagaattg
agatgtctcgatcccaggtaccagacagaattaagagagtatgagactcgacacttgcaa
gaatcaaggagagctttgcatccatcgcctgagttgggcaacaggaagatgagagtggag
agtggcaccgcaggttccttggttaaaccttcgcaaacttctgatgacaagctaatgaaa
tcctttcatttgggaacgcatttttcatttcgcatcccacatggcgacacagacccaatc
cttacaaagaagagttttccagccgatactaatgcagggtattgctggagtagccgcccc
aatttgggatcccaaagggcctga

DBGET integrated database retrieval system