KEGG   Elaeis guineensis (African oil palm): 105055137Help
Entry
105055137         CDS       T03921                                 

Definition
(RefSeq) RNA pseudouridine synthase 2, chloroplastic isoform X1
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:egu03009]
    105055137
Enzymes [BR:egu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     105055137
Ribosome biogenesis [BR:egu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    105055137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-GeneID: 105055137
NCBI-ProteinID: XP_010935174
Position
12
AA seq 449 aa AA seqDB search
MNRRLLFYRRERMVSLSLPAAGSSSQLSFSLDLLRRDPRDRVSKALCSSTSTSSRDSNPE
PFQRQQRVITGNHAGLRLEERVEIGAEKTRLDSWISSRIETVSRARIQSSIRSGLVTVNG
RTVDKVSHIIKGGDMVSCTVSELQPLRAEAEDIPLDIVYEDAHVLVVNKPAHMVVHPAPG
NANGTLVNAILHHCRLPTIACVNKSKISESEDCSESSDSEMDNYYFDQSSVEGISSENSE
ALVRPGIVHRLDKGTSGLLVVAKDEHSHAHLAEQFKLHTIHRVYISLTCGVPNPSSGRIE
IPIARDSNNRIRMAAVLGTSNSRHARYAASRYKVIELLGRGGSALVEWRLETGRTHQIRA
HAKYMGIPLLGDEVYGGTKSMALSLLRPRTSSSHHGHLSQILSKLQRPCLHASSLGFKHP
HTGEYLRFSCPPPDDFAEVLDQLQSICPC
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaggctcctattctaccgccgtgagaggatggtatcgctctcgcttccagct
gccggctcttcttcgcagctctccttctctctcgaccttctccgtcgagaccctcgggat
cgggtttcgaaggccctctgctcctctacttctacttcttcacgcgattcgaatccagag
ccatttcagcggcagcagcgagtcatcacaggtaatcatgcgggactgcggctagaggag
agggtggagattggagcggagaagaccaggctcgactcctggatctcctctcggatcgaa
actgttagccgagctcggattcagtccagcatccgctccggcctcgtcaccgtcaatggc
cggacggtggacaaggtttcacacattatcaaaggaggggacatggttagctgcacagtt
tctgagttgcagcccttgagagctgaagcagaagatattcctctggatatagtgtatgaa
gatgctcatgttcttgtagtaaacaaacctgcgcacatggttgttcacccagcacctggc
aatgcaaatggcacactggtgaatgctattcttcatcattgtaggcttccaacaattgca
tgtgtaaacaaaagcaaaatttctgaatctgaggattgctcagaatcttcggacagtgag
atggacaattattattttgatcaatcctctgtggaaggaattagttcagaaaattctgaa
gctcttgttcgccctggtattgtgcacagactggacaaagggacaagtggattgcttgtt
gtagccaaggatgagcattctcatgcccatttagctgaacagttcaagctacacactatc
catagagtatacatcagtcttacttgtggagtccctaacccaagttctggaaggattgaa
ataccaatagctcgtgattcgaataatagaattcgcatggctgccgttttggggacaagt
aacagtagacatgctcgttatgctgctagtaggtataaagttattgagcttcttggccgt
ggtggatcagcattagtggagtggagattggaaacgggccgcactcaccagatccgtgca
catgcaaaatatatgggaattcctctattaggcgatgaggtgtatggcggtactaaaagc
atggcactgtcgctgttgaggccaagaacttcttcaagtcatcacggccatctctctcaa
attttatcaaaactacagaggccttgccttcatgcttcatcactaggatttaagcatcct
catacaggtgagtatctacggttctcatgcccaccaccagatgattttgctgaggtattg
gatcaacttcagagcatatgtccttgctga

DBGET integrated database retrieval system