KEGG   Elaeis guineensis (African oil palm): 105056416Help
Entry
105056416         CDS       T03921                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egu01001]
    105056416
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105056416
Protein kinases [BR:egu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   105056416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PIP49_C YukC APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 105056416
NCBI-ProteinID: XP_019709996
Position
13
AA seq 301 aa AA seqDB search
MTRHFKHKLGQGGFGTAYKGELPNGIPVAVKMLMKSKGEGEDFINEVAIVGRIRHSNVVR
LLGFCSEGTWRALIYEFMPNESLEKYIFNKRNKTSHQPNWIKKMQEIAIGIAQGIEYLHQ
GCNQRIFHFDIKPHNILLDHDFNPKIADFGLAKLCSRDQSITTITATRGTMGYTAPKIYC
RNFETVSYKSDVYSFGMLVLEMVGGRKNVGPKIEKTSEIYFPEWVYGRIFHGHDLRLVME
RNGVEEDIAKKLAIVALWCIQWNPMDRPSITRVVQMLMGNLESLQISSTPFVSSIGQENG
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcattttaagcataaattaggccaaggtggatttggaaccgcatataaaggg
gagctaccaaatggaattccagtggcagttaagatgctgatgaaatctaaaggggaggga
gaagacttcatcaatgaagtagccatagttggaagaatccgccattccaatgtggttcgt
ctcttgggtttttgttcggaaggaacatggcgtgcacttatttatgaatttatgccaaat
gagtcactggagaagtacattttcaataaaagaaataaaacaagtcatcaaccaaattgg
ataaaaaagatgcaagagattgctattgggattgctcagggtatcgagtatttgcatcag
ggatgcaatcaacgcatcttccattttgacatcaaacctcacaacattttgttggaccat
gacttcaatccaaaaattgcagattttggtcttgcaaagttatgctcgagagaccagagt
attaccacgataaccgctacgaggggaacaatgggctacactgcacccaagatttattgt
agaaattttgaaacagtgtcttataaatcagatgtctatagttttggaatgttggtgctg
gaaatggtgggtggcaggaagaatgttggtcctaaaattgagaaaacgagtgagatatat
tttccagagtgggtatatggccggatatttcatggacatgatctaagattggtgatggag
aggaatggagttgaagaagatattgccaaaaagcttgcaatagtagcattgtggtgtata
cagtggaacccaatggatcggccctccattacaagagtggttcagatgctgatgggaaac
ctggagagcttgcaaatatcttccacacctttcgtctcctccattggtcaagagaatggc
gggtaa

DBGET integrated database retrieval system