KEGG   Elaeis guineensis (African oil palm): 105057476Help
Entry
105057476         CDS       T03921                                 

Definition
(RefSeq) beta-glucosidase 22-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00460  Cyanoamino acid metabolism
egu00500  Starch and sucrose metabolism
egu00940  Phenylpropanoid biosynthesis
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105057476
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    105057476
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    105057476
Enzymes [BR:egu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     105057476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 105057476
NCBI-ProteinID: XP_010938395
Position
14
AA seq 516 aa AA seqDB search
MRRGGSISSLLLVLLLSLGEGSLGHTATKFSRDDFPPDFVFGAGTSAYQVEGAAAEDGRS
PSIWDTFTHAGGMQDKSIGDVASDGYHKYKEDVKLMTDTGLEAYRFSISWSRLLPYGRGY
VNPKGLEFYNNLINELIENGIQPHVTLYHLDLPQVLEDEYGGWLSPKIVDDFTAYADVCF
REFGDRVSYWTTIVEPNIIGMGCYDTGIWPPSRCSYPFGINCTAGNSTTEPYIAVHNILL
AHASVVTLYKNKYQAVQNGWIGINVYSFWFRPFSNSTADVEATQRSLDFIVGWILNPLVF
GDYPKVMKQNAGSRLPSFNKHQSKQLKGSFDFIGLNHYTSVYVKDNSNGLKPSLRDFNAD
MFALLSASRNDTPSGRYVPTHILVDPAGLQYMLEYIKEVYGNPPIYIQENGFGLGVNDTL
NDTARIDFLSGFMGSTLEAFRNGSNVRGYFVWAFLDVFEFLAGYDSRYGLYHVDFEDEER
RRQPRRSAFWYSQFLKKKSSRNVRMTSLISASHAQQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggggaggatccatttcttctttattgctagtgcttctgctatctttaggagag
ggtagtttaggccacactgccaccaaatttagcagggatgacttcccaccggactttgtc
tttggagctggaacctcggcttaccaggtggagggagcagcagctgaggatggaaggagt
cctagcatatgggatactttcactcatgcagggggcatgcaagacaagagcataggtgat
gtagcttcagatgggtaccacaaatacaaggaagatgtcaagctaatgactgacacaggt
ctggaggcttacagattctccatctcttggtcaaggcttctcccatatggcagaggatat
gtcaatcctaaaggcctggagttctacaacaacctgatcaacgagctaatagaaaatgga
attcagccacatgttacactctaccatctcgatcttccccaagtactggaagatgagtat
ggaggatggctgagccccaagatcgtggatgatttcacagcatatgcagatgtgtgcttt
agggaatttggcgatagagtttcctattggactaccattgttgagcccaatataataggg
atgggatgctatgacaccggaatatggccacctagccggtgctcttatccatttggcatc
aattgcacagccggcaattccaccacagagccatacattgcagttcacaacattctacta
gcgcatgcatcagttgtcacactatataagaataaatatcaagctgtgcaaaatggatgg
ataggcataaatgtctactccttctggtttcgcccattttcaaactccacagcagatgtc
gaagcaactcaaagatcattagacttcattgtgggctggatcttaaatcccctagtgttc
ggggactatccaaaggtcatgaagcagaatgctggctcgaggctcccatccttcaacaaa
caccagtccaaacaattaaagggttcttttgactttattggtctgaaccactacacttca
gtgtatgtcaaagacaactctaatggtctgaagccaagtctccgtgacttcaatgcagat
atgttcgccctactttcagcttctaggaatgacacaccatctggtcggtacgttccaacc
cacattctagtggatccagctgggctacaatatatgttggagtatattaaagaagtctat
ggaaatcctcctatttatatccaagaaaatggttttggacttggagtcaatgacactttg
aatgatactgcaaggatcgatttcttgagtggtttcatgggaagcacacttgaagctttc
aggaatggatcaaacgtgagaggatactttgtgtgggcattcttagatgtcttcgagttt
ttggctgggtatgattcgcgctatggactatatcatgtagattttgaggatgaggaacgc
agaaggcaaccgaggcgctctgcgttttggtactctcagttccttaagaagaaaagcagc
aggaatgtaaggatgaccagcctaatttctgcatcccatgcacaacaatga

DBGET integrated database retrieval system