KEGG   Elaeis guineensis (African oil palm): 105057640Help
Entry
105057640         CDS       T03921                                 

Definition
(RefSeq) serine--glyoxylate aminotransferase-like
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00250  Alanine, aspartate and glutamate metabolism
egu00260  Glycine, serine and threonine metabolism
egu00630  Glyoxylate and dicarboxylate metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
egu04146  Peroxisome
Module
egu_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105057640
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105057640
   00260 Glycine, serine and threonine metabolism
    105057640
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105057640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:egu01007]
    105057640
Enzymes [BR:egu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     105057640
    2.6.1.45  serine---glyoxylate transaminase
     105057640
    2.6.1.51  serine---pyruvate transaminase
     105057640
Amino acid related enzymes [BR:egu01007]
 Aminotransferase (transaminase)
  Class V
   105057640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 105057640
NCBI-ProteinID: XP_010938608
Position
14
AA seq 401 aa AA seqDB search
MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG
TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGRG
ANLDMLAMKLATDTAHTIKAICIVHNETATGVTNNLATVRNLLDEYNHPALLLVDGVSSI
CALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWNDYLKF
YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNCTQK
EEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
GCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggattatgtttatggtcctgggaggaaccatctctttgttcctgggcctgtgaatatc
ccagagcctgtgatacgggctatgaacaggaacaatgaagattacaggtccccagctgtg
cctgcgctgacgaagactcttattgaggatgttaagaagatcttcaagacaacaagtggg
actccttttctaattcctacaacaggtactggagcttgggaaagtgcattaacaaacaca
ttatcacctggtgatagaattgtatcttttcttattgggcaattcagtcttctctggatt
gatcaacaacaacgcctcaaatttgatgtggatgtcatagaaagtgagtggggacgaggt
gccaatcttgatatgttggcaatgaaactagctacagacacggctcatacaattaaggca
atctgtattgttcacaatgagacagcaactggagtcaccaataatttggcaactgtaaga
aacttgctagatgagtacaaccatcctgcactattgcttgttgacggtgtgtcatcgata
tgtgctcttgactttcgtatggatgaatggggagttgatgtagctttaactggatcacag
aaagctctttctttgcctactggaatgggcattatctgcgctagcccaaaagcactggaa
gcctctaagacagccaaatcagtaagggtgttctttgactggaatgactacctgaagttc
tacaaaatgggaacttattggccctatactccttctatccaacttctgtatgggctcaga
gcagctttggatcttatatttgaggaaggacttgacaatgtgatcgcaaggcacaaccgt
ttagggaaagcaacaagacttgctgttgaggcttggggcctgaagaattgcacacagaag
gaggaatggtttagtgacacagtcaccgcagtggttgttccaccttatattgacagtgct
gaggttgttaggagggcatggaagagatacaatttaagcttaggcttgggcttgaacaaa
gtggcgggaaaggtgttcaggataggacatctaggtaacctcaacgagctgcaactgtta
ggctgtcttagtggggtggagatggtactcaaggatataggctacccggtcaagctggga
agtggagtgggagcagcagctgcttatcttcagaacactaccccaatgatcccttcgagg
atataa

DBGET integrated database retrieval system