KEGG   Elaeis guineensis (African oil palm): 105057765Help
Entry
105057765         CDS       T03921                                 

Definition
(RefSeq) probable glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00480  Glutathione metabolism
egu00590  Arachidonic acid metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105057765
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105057765
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     105057765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin TPR_18
Motif
Other DBs
NCBI-GeneID: 105057765
NCBI-ProteinID: XP_010938757
Position
14
AA seq 173 aa AA seqDB search
MGAFQSQPSQTKTSIHQFTVKDSSGKDVDLGIYKGKVLLVVNVASKCGFTESNYTQLTGL
YNKYKNKDFEILAFPCNQFLRQEPGTNQEIKSFACTRYKAEYPIFQKVRVNGSDTVPVYQ
FLKASKSGILGSRIKWNFTKFLVDKEGKVIGRYAPTTSPLSIEKDIQKALGET
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggggctttccaatcccagccctcacagaccaagacttccatccatcaattcacggtc
aaggatagcagcggcaaggacgtggatttggggatttacaaggggaaggtgcttctcgtc
gtcaatgttgcctccaaatgtgggttcacggaaagcaactacacccaattgactgggctc
tacaacaagtataaaaataaagattttgaaattttagcatttccatgcaatcagtttttg
cgacaagaacccgggacaaaccaggagataaagagttttgcttgtacaagatacaaggct
gagtatccaattttccaaaaggttcgagtaaatggttcagacacagtgccagtttatcaa
tttcttaaagcaagcaaatctggtatattgggttctcgaataaagtggaattttaccaag
tttctagttgataaggagggcaaagtgattggtcgatatgcgccaacaacttccccattg
tccattgagaaagacatccagaaagcacttggagagacttag

DBGET integrated database retrieval system