KEGG   Elaeis guineensis (African oil palm): 105058275Help
Entry
105058275         CDS       T03921                                 

Definition
(RefSeq) flavonoid 3'-monooxygenase-like
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00941  Flavonoid biosynthesis
egu00944  Flavone and flavonol biosynthesis
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    105058275
   00944 Flavone and flavonol biosynthesis
    105058275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:egu00199]
    105058275
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     105058275
Cytochrome P450 [BR:egu00199]
 Cytochrome P450, plant type
  CYP75 family
   105058275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 105058275
NCBI-ProteinID: XP_019710652
Position
15
AA seq 220 aa AA seqDB search
MAHKQGGLKGKATEALALGPRPQEAPRSRASGIAVQPPPSASGVPVQTSSLCLRRPDPPP
RPPPNLFTAGTETALIELTKQPGILRKAQFELDSVVGRDRLICGSDLPNLPFIQATSRET
FRLHPSTPLSVPRMSSEACEVTGYHIPKGATLLVNVWAIVCDLAVWHDPLEFQPARFLPG
GGYDHVDVKGNDFGIIPFGAGISLGIRMVQFMIANIGAYF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacaagcaaggggggctgaagggtaaggccaccgaagcccttgccttaggcccc
cgcccccaggaggccccccgctcgcgtgcatctggcatcgcggtccagcctccgccttcc
gcctccggcgtcccggtccagacatccagtctctgcctccgacgtcccgatccacccccc
cggcctccaccaaacttattcacggcagggacagagacggccttgatagaactcaccaag
caaccaggcatcctcaggaaggctcaatttgagctcgactctgttgtgggccgagaccgg
ctcatctgcgggtcagacctgcccaatcttcccttcattcaggcaaccagcagagagaca
ttccggctccacccatcaacaccactctccgttccccgcatgtcctcagaagcttgcgag
gtcactggctaccacattccaaagggtgcaactctcttagtgaatgtatgggccatcgta
tgtgacctggccgtgtggcatgacccgctcgagttccagcctgcccggttcctcccaggc
ggcggctatgatcacgtggatgtgaaggggaatgattttgggatcattccatttggtgcc
ggcataagcctaggtataaggatggtccagttcatgatagctaacattggtgcatacttt
taa

DBGET integrated database retrieval system