KEGG   Elaeis guineensis (African oil palm): 105058932Help
Entry
105058932         CDS       T03921                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egu04131]
    105058932
Membrane trafficking [BR:egu04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    105058932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 ANAPC4_WD40 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 105058932
NCBI-ProteinID: XP_010940318
Position
16
AA seq 968 aa AA seqDB search
MNIEELKSKREREENRAAGPIRATQISPAIMASDHTLENGVDGDDEREEDDDEEEEEEED
GEEEEEEEEEEEPRLKYQRLGGSVPSLLSTDAASSIAIAERMIALGTHDGTVHILDFQGN
QVKEFAAHTATVNDLCFDVEGEYIGSCSDDGSVVIYGLFTDERLKFEYYRPMKTIALDPD
YSRKSSRRFVAGGLAGQLFLNTKNWLGYSKQVLHDGEGPIHAVKWRTSLIAWANDAGVKV
YDMANNQRITFIERPRGSPRPELLLPHLVWQDDTFLVIGWGTCVKIAAIRTNPPRGANGI
EKNMPISTMKYVDIVASFQTSYYISGIAPYGDALVILAYIPEEENGEKDFSSTIPSRQGT
AQRPEVHIVTWKNDELTTDALPVHGYEHYKAKDYALAHAPFAGSSYAGGQWAAGDEPLYY
IVSPKDVVIAKPRDAEDHISWLLQHGWHEKALAAVEAGQGRTELLDEVGSRYLDHLIVER
KYAEAASLCPKLLRGSASAWERWVFHFAHLRQLPVLVPYMPTENPRLRDTLYEVALVALA
TSPSLHQLLLATVKSWPTTLYSASTVISAIETQLNTSSMTDSLKEALGELYIIDTQYEKA
FSLYADLMKPEIFDFVEKHSLHDAIHDKVVQLMILDSKRAVSLLIQHRDIISPSEVVGQL
LHDSKKCDNRFFLHLYLHSLFDIDSEGGKEFHDLQVELYAEYEPRMLLPFLHSSHHYKLE
KAYEICVKKDLVREQAFILARMGNAKRALAVYINKLEDIEEAVDFVSTQHDDDLWEELIK
QCLHKPEMVGMLLEHTVGNLDPLYIVSMVPNGLEIPRLRDRLVKIITDYRTETSLRHGCN
DILKADCVNLLIKYYKEARRAIYLGSIEEETRGKRENEASAPTIERVANARMMVVQSITR
GNGRCCLCFDPLSIQNVNVVVFFCCHAYHVPCLQDGSDAVGTVSNNDDDHDDDGGSRMRC
VLCTTAGG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgaagaactaaaatccaaaagagagagggaggagaaccgggccgccggtcca
attcgcgccacccagatctcgccggcgatcatggcatccgaccacaccttggaaaacggt
gtcgatggcgacgacgagagagaagaagacgacgacgaggaggaagaggaggaggaggac
ggggaagaagaggaggaggaggaggaggaggaggagccgaggctcaagtaccagagatta
ggaggcagcgtgccgtctctcctttcgaccgatgccgcgtcctccatcgccatcgcggag
cggatgatcgcgctcggaacccatgatggcaccgtccacatccttgatttccagggcaat
caggttaaagaatttgctgctcatacagctactgtcaatgacctttgttttgatgtggaa
ggcgaatatattggcagctgctcagatgatggatctgtggtcatatatggtctctttaca
gatgaaaggttaaaatttgagtattatcgtcctatgaaaaccatagctctagaccctgat
tattcaagaaaatcatccagaagatttgttgctggtggtttagctggtcaacttttttta
aatacaaagaactggctaggctacagcaaacaggttctacatgatggcgaaggtccaata
catgctgtgaagtggaggacaagtcttattgcttgggcgaatgatgcaggggtgaaggtt
tatgacatggcaaataatcaacgcatcacatttattgagaggccacgaggaagtccacgg
cctgagcttttacttcctcacttagtttggcaggatgacactttcttggtaattggctgg
ggaacatgtgtaaagattgcagctattagaaccaatccacctcgtggagcgaatggaata
gaaaagaatatgcccatatcaaccatgaagtatgtggatattgtggcatcttttcagact
agctactatatatctggtattgcaccctatggtgatgctttagtcattctagcatacatt
cctgaggaggagaatggagaaaaagattttagtagcaccattccatcacgccagggaact
gcacagagaccagaagtacacattgtgacatggaaaaatgacgaacttacaacagatgct
ctacctgtgcatggctatgagcattacaaggcgaaggattatgcccttgcacatgcccct
tttgcaggaagcagctatgcaggtggccagtgggctgctggtgatgaacctttgtattac
atcgtatctcccaaggatgttgtgattgcaaagcctagggatgctgaagatcatatatct
tggcttcttcaacatggttggcatgaaaaagcattagctgcagttgaagcaggacaagga
cggactgagcttcttgatgaggtgggatctagataccttgatcatttaattgttgaaaga
aaatatgcagaagctgcttctttgtgtcctaaattactacgtggatctgcttcagcctgg
gagagatgggttttccactttgctcatctccgccagctgcctgttttggttccttacatg
cctacagaaaatccacggctgcgtgatactctttatgaggttgcccttgttgctttagct
actagtccatcattacaccagcttctcttggcaactgttaaatcatggccaactacatta
tattcagcatcaactgttatctctgctattgagactcagcttaatacctcctccatgact
gattcactaaaagaggctttaggtgaactatacataattgatactcagtatgagaaggct
ttttcattatatgctgatctgatgaagcctgagatatttgacttcgttgaaaaacatagc
ttgcatgatgccattcatgataaggttgtccagctgatgatactggacagtaaaagagcc
gtatctctattgattcaacatcgtgatataatatccccttctgaagttgttggacaactg
ttgcatgacagtaaaaagtgcgacaatagatttttcttgcatttatacctgcattcactg
tttgacattgactcagaaggagggaaagaattccatgatttgcaggtagagctttatgct
gaatacgagccacgaatgctactcccatttcttcatagcagtcatcattataagctagag
aaggcttatgaaatttgtgttaagaaagatcttgtaagagagcaggcatttatccttgca
aggatgggcaatgccaaaagagcgcttgcagtttacataaataagttggaagatatagag
gaggctgtggatttcgtaagtacacagcatgatgatgatctatgggaggagttaattaag
caatgtctccataagcctgaaatggttgggatgttgttggagcacactgttggtaatctt
gatccgctgtatattgtcagtatggtgcccaatggattagagataccacggttaagagat
cgccttgtcaaaatcatcactgattatcgaacagaaacctctcttagacatggatgtaat
gatatcctcaaggctgactgtgtcaatctgttgatcaagtattacaaagaggctcggcgg
gccatctacttgggcagtatagaagaagaaacacgtgggaagagggaaaatgaggcttct
gctccaacaattgagagagtagcaaatgcaagaatgatggtagttcaatccataacaagg
ggcaatgggaggtgttgcttgtgctttgatcctttgtccattcaaaacgtcaatgtcgtt
gtattcttttgctgccatgcatatcatgtcccctgtctccaggatggctcagatgctgtg
ggcactgtatctaataatgatgatgaccatgatgatgatggtggatctcgaatgcgttgt
gttttatgcactacagctggtgggtaa

DBGET integrated database retrieval system