KEGG   Enterococcus gilvus: EGCR1_08235Help
Entry
EGCR1_08235       CDS       T05664                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
egv  Enterococcus gilvus
Pathway
egv00030  Pentose phosphate pathway
egv00480  Glutathione metabolism
egv01100  Metabolic pathways
egv01110  Biosynthesis of secondary metabolites
egv01120  Microbial metabolism in diverse environments
egv01130  Biosynthesis of antibiotics
egv01200  Carbon metabolism
Module
egv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
egv_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:egv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EGCR1_08235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EGCR1_08235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egv04147]
    EGCR1_08235
Enzymes [BR:egv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EGCR1_08235
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EGCR1_08235
Exosome [BR:egv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EGCR1_08235
  Exosomal proteins of colorectal cancer cells
   EGCR1_08235
  Exosomal proteins of bladder cancer cells
   EGCR1_08235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AXG38696
UniProt: A0A345FSG4
Position
1696738..1698255
Genome map
AA seq 505 aa AA seqDB search
MEQAALFTIFGGTGDLAKRKLYPSLFRLYKKGNLTKHFAVIGTARRPWSDDHYREIVRET
IQDLAPTEEEAQEFSNHFYYLSHNVNDTEHYDQLKDLADELDEKYDLQGNRIYYLAMAPQ
FFGTIVSHLKSQEILTTTGYNRLVIEKPFGFDYDSANELNNEIRDVFPEQDIFRIDHYLG
KEMIQNISVIRFANNIFESLWNNRYIENVQITFSEALGVEDRGGYYEHSGALKDMVQNHI
LQVVALLAMEVPTSFSNKSIREEKVKVLQAIRRYNPEEVLQNFVRGQYDAGTLDGKDFVA
YHDEPNVAEDSLMETFVAGKFMIDNFRWSGVPFYIRTGKRMTEKGTRINIVFKQVPVNVF
SSEQEDVSSEEELPQNILTIYIQPTEGFSLTLNGKRIGQGFTTEPVKLDFRQSAEVTENS
PEAYEKLLLDALNGDGTNFSHWDEVANSWEIVDRIRNTWDQTTPGFPNYASGTMGPQCAF
DLLAKNGHEWAWQPDQWYRERGKLD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggcagcactattcaccatctttggtggcacaggcgatttagcaaaacggaaa
ttatacccgtcgttgtttcgtctatataaaaaaggcaatctgacaaaacactttgctgtg
atcggtacggctagacggccgtggagcgacgatcattatcgtgagatcgttcgtgagacg
atccaggacctcgccccaacagaggaagaagcacaagaattctctaaccacttttactac
ttgtcacacaatgtcaatgacactgaacattatgaccagctaaaagatttggctgatgaa
ttggatgaaaagtatgacttgcaaggcaatcgcatatattacttagccatggcacctcaa
ttttttggaaccatcgtgagtcatttgaaatctcaagaaattttgactactacaggatat
aaccgtttagtgatcgaaaaacctttcggatttgattatgattctgcaaatgaactgaat
aatgagattcgcgacgttttcccagagcaagacattttccgtatcgatcactatttagga
aaagaaatgattcaaaatatttccgtgatccggtttgcaaataacatctttgaatccctt
tggaacaaccgttacatcgaaaacgttcaaattactttttctgaagcactaggtgtagaa
gatcgcggtggttactatgaacacagcggcgcgttaaaggatatggtgcaaaatcatatc
ttgcaagttgttgcgctgttggcgatggaagttcctacttctttctcgaacaagtccatc
cgtgaggaaaaagtaaaagttttacaagctattcgtcggtacaatcccgaagaagtactg
caaaactttgttcgtggacaatatgacgcagggacgttagatggcaaagatttcgttgct
taccacgatgagccaaatgtcgctgaagattctttaatggaaacatttgttgcaggtaaa
tttatgatcgataatttccgttggtcaggtgtcccgttctatattcggactggtaaacga
atgactgaaaaaggaacacgtatcaatatcgtctttaaacaagttcctgttaatgtcttt
agctctgaacaagaagatgtttctagtgaagaagaattgccgcaaaatatcttgaccatt
tatattcaacctacagaaggcttctcgcttactttaaacggaaaacgaatcggccaaggt
ttcacgaccgaaccagtaaaattagatttccgtcaaagcgctgaagtaacagaaaacagt
cctgaagcctatgaaaaactattattagatgctttaaatggcgatggtacaaacttctct
cattgggacgaagtagcaaactcttgggagatcgtggatcgtatccgcaatacttgggat
caaaccactccaggcttcccgaactacgcttctggaaccatgggaccacaatgcgccttc
gatcttctagccaagaatggtcatgaatgggcttggcagcctgatcaatggtaccgtgaa
cgcggaaaattggattaa

DBGET integrated database retrieval system