KEGG   Egretta garzetta (little egret): 104122050
Entry
104122050         CDS       T05152                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:egz01002]
    104122050 (ERAP1)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     104122050 (ERAP1)
Peptidases and inhibitors [BR:egz01002]
 Metallo peptidases
  Family M1
   104122050 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Prok-E2_E DUF1570
Other DBs
NCBI-GeneID: 104122050
NCBI-ProteinID: XP_009632420
Position
Unknown
AA seq 823 aa
LVLEQQRSEQVALLAAEPLRAGHNYTLSIQYLANLSESFHGFYKSTYRTREGELRVLAAT
QFEPTAARMAFPCFDEPAFKARFSITIRREPKHLALSNMPIVKSVNITPWLVEDHFDTTV
KMSTYLVAFIVSDFKSISKVTTHGVKISVYTVPDKINQADYALDAAVKLLDFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESVLLYDPEKSSASSKLGITMTIAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSATHPELRVEDFFLRRCFGAMAVDALNSSHPIS
TPVEDPAQILEMFDTVSYEKGSCVLNMLRDYLTADVFKTGLVQYLQKYSYQNTKNEDLWN
SMTNICPTVGSDKNDLQGDGFCRKSPHSSSNAHWTKGETLDVRAMMDTWTLQKGFPLVTV
TVRGKNVHLQQERYVKGGDSPSSSGYLWHIPLTYITSKSDTVQRFLMTTKADVIILPEEV
EWVKFNVDMNGYYIVHYEDDGWDRLITLLKENHTVISSNDRASLINNIFQLVRMKKLSIS
KAFDLTLYLKHERQIMPVLQGMNELIPIYRLIERRDMDGTEKQLKEYIVHLFKDLIDRQS
WSDEGSLSERLLRDSLLWFACIHKYQPCVDKAKGYFTEWQKSDGTLSLPADVKAAVYAVG
AQTSEGWDFLLSKYRLHSFNVERENIELALSLSRSKDKLQWLMDQGLRGDIIRTQDLPHV
IVFVAKNPSGYHLAWAFLKENWKKVVEKFELGSNSVASIVTGVTSRYSTRSQLAQVKEFF
SSLEEKSSQLRCVQQAIETIEDNILWMDRNFEEIKVWLQTNRL
NT seq 2472 nt   +upstreamnt  +downstreamnt
ctggtgctggagcagcagcgctcggagcaggtggcactcctcgccgccgagccgctgcgg
gccgggcacaactacaccctcagcatccagtacttggcgaatctctccgagtccttccat
ggcttctataaaagcacctacaggacccgggaaggagaactcagagtgcttgcagcaaca
cagtttgagccgacagctgcccgaatggccttcccgtgtttcgacgaaccagccttcaaa
gccaggttttccattacaattaggagggaaccaaagcaccttgcactgtccaatatgcca
attgtgaagtctgtgaatataactccctggcttgttgaggaccattttgataccactgtc
aagatgagtacgtacctcgtggcctttattgtttcggattttaaatccatcagcaaagta
accactcatggagttaagatttctgtgtacacggtgccagacaagatcaaccaagctgat
tacgcgctggatgcggcagtgaaacttttagacttctatgaggattacttcagcattccg
tatcctttacctaagcaagatttagcagctattcctgattttcagtctggtgctatggaa
aactggggactgactacataccgggaatctgtgttgttgtatgaccctgaaaagtcctcg
gcatcatctaaacttgggattactatgacaatagcccatgagctagctcatcagtggttt
ggcaacctcgttaccatggagtggtggaacgatctgtggttgaatgaagggtttgcaaag
tttatggagttcgtgtcagtcagcgctacccacccagagctgagagttgaagactttttc
ttaaggagatgttttggtgccatggcagtggatgcgttaaattcatcacatcctatatct
actcctgtggaagacccagctcaaattttagaaatgtttgacacagtttcttatgagaag
ggatcttgtgtattaaacatgctgagggactacctgactgctgatgtgtttaaaactgga
cttgtccagtacctgcagaaatacagctatcagaatacaaaaaatgaagatttgtggaac
agcatgacaaatatttgccctacagttggtagtgataaaaatgacctgcaaggtgatggt
ttttgtagaaaaagcccacactcatcttcaaatgcacactggactaaaggagagactctt
gatgtgagggcaatgatggacacgtggacactgcagaagggttttccgctggtaacggtc
acggtgagagggaagaacgtccacctgcagcaggagcgatacgtgaagggaggagattct
ccttcatcctcagggtacttgtggcacattccactaacctacattaccagtaagtctgac
accgttcagaggtttctgatgacgactaaagcagatgtcattatccttccggaagaggtg
gagtgggttaagttcaacgtggacatgaatgggtattacattgtgcactacgaagatgat
ggatgggatcgtctgatcacccttctgaaagagaaccatacagtgattagcagcaacgac
agagcaagtctcattaacaacatattccagcttgtgagaatgaaaaaattatcaatttcc
aaagcttttgatttgactttgtacctgaaacatgagagacaaatcatgcctgtgctgcaa
ggtatgaacgagctgatcccgatatacaggctcattgagaggagggatatggatggtaca
gaaaaacagttaaaggagtatatagtccatctatttaaggacctgattgacaggcagtct
tggagcgatgaaggctcgctgtctgagaggttgcttagggactcgcttctgtggttcgcc
tgcatccacaagtaccagccatgcgtggacaaagccaagggatattttacagaatggcag
aaatccgatggaaccttgagcttgccagcagatgtgaaggcagccgtgtatgctgttgga
gcacagacatcggaaggctgggatttcctcctcagtaaatacagactgcactcgttcaac
gtagagagggagaacattgagttagcgctcagcctgagcagaagtaaggacaagcttcag
tggttaatggatcaaggtctgcgtggtgacatcatacggactcaggacctcccacacgtt
attgtctttgttgccaaaaacccatctgggtatcacctagcttgggcatttttaaaagaa
aattggaagaaagttgtagaaaaatttgaactcggttcgaattccgtggcaagcattgtc
actggggtgacaagtcggtactcaacaagatcacagcttgcacaggtgaaagaattcttc
agttctctggaggaaaaaagctcacagctccgctgtgtccagcaggccattgagaccatt
gaagacaatatactgtggatggatagaaattttgaggaaatcaaagtgtggttgcaaacc
aaccgcctgtaa

DBGET integrated database retrieval system