KEGG   Egretta garzetta (little egret): 104123781Help
Entry
104123781         CDS       T05152                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00010  Glycolysis / Gluconeogenesis
egz00053  Ascorbate and aldarate metabolism
egz00071  Fatty acid degradation
egz00280  Valine, leucine and isoleucine degradation
egz00310  Lysine degradation
egz00330  Arginine and proline metabolism
egz00340  Histidine metabolism
egz00380  Tryptophan metabolism
egz00410  beta-Alanine metabolism
egz00561  Glycerolipid metabolism
egz00620  Pyruvate metabolism
egz01100  Metabolic pathways
Module
egz_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104123781 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    104123781 (ALDH2)
   00620 Pyruvate metabolism
    104123781 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104123781 (ALDH2)
   00561 Glycerolipid metabolism
    104123781 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104123781 (ALDH2)
   00310 Lysine degradation
    104123781 (ALDH2)
   00330 Arginine and proline metabolism
    104123781 (ALDH2)
   00340 Histidine metabolism
    104123781 (ALDH2)
   00380 Tryptophan metabolism
    104123781 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104123781 (ALDH2)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104123781 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 104123781
NCBI-ProteinID: XP_009634365
Position
Unknown
AA seq 422 aa AA seqDB search
MDASHRGRLLNRLADLIERDRAYLAALETLDNGKPYSVSYLVDLDMVIKCIRYFAGWSDK
FHGKTIPLDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LSALYIANLIKEAGFPPGVVNIIPGYGPTAGAAISSHMDVDKVAFTGSTEVGHLIQKAAA
ESNLKRVTLELGGKSPNIIMSDADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYHEF
VERSVEKAKSRVVGNPFDFKTEQGPQVDEEQFKKILGYISTGKREGAKLLCGGNPAADRG
YFIQPTVFGDVQDNMTIAREEIFGPVMQILKFKTIEEVIERANDSKYGLAAAVFTKDLDK
ANYVSQGLRAGTVWINCYDVFGAQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttctcatcgggggaggctgctgaatcgtcttgctgacctgatcgagagggac
cgggcttacctggcggcgctagagactctggataatggcaaaccgtactccgtctcctac
ctggtggatttggacatggtaatcaaatgtatcagatactttgcaggttggtcagacaaa
ttccatgggaaaaccatcccgttagatggagacttcttctgttacacaagacatgagccg
gtgggagtttgtggacagataatcccgtggaacttcccgttgttgatgcaagcatggaaa
cttgggcctgccctggctactgggaacgtggttgtgatgaaagtggcggagcaaaccccg
ctgagtgctctctacatagctaatctgatcaaagaggctggattcccgccaggcgtggtg
aacatcatccccggctatgggcccactgcaggggctgccatctcttcccacatggacgta
gataaagtggccttcaccggctccacggaggtcgggcacctgatccagaaggctgcagca
gagagtaacttaaagagggtgacactggagcttggaggaaagagtccaaatataatcatg
tctgatgcagacatggactgggctgtggatcaagcccattttgccctcttcttcaaccaa
gggcagtgctgctgtgctggatcccgaacatatgtccaggaagatatatatcatgagttt
gtggagaggagtgttgagaaggccaagtccagggtggttggaaacccatttgactttaaa
actgaacaggggcctcaggtcgatgaagagcagtttaagaagatcctcggttacattagt
actgggaagcgtgaaggagccaaactgctgtgtggtggcaaccccgctgcggacagaggc
tatttcatccagccaactgtctttggcgatgtgcaggacaacatgacgattgccagagag
gagatatttgggccggtcatgcagattctgaaattcaaaacaattgaggaagtcatcgag
agggcaaatgactccaagtacgggctggcagcagcagtctttacaaaggatcttgacaaa
gcaaactatgtgtcacagggcctgcgagctggaacagtttggataaactgctacgatgtg
tttggtgcgcaagccccgtttggtggctacaaagcttctgggaatgggcgagaactggga
gaatatggcctggaggcgtatgtagaggtgaaaaatgtcacaatcaaaattccacagaaa
aattcctaa

DBGET integrated database retrieval system