KEGG   Egretta garzetta (little egret): 104123879Help
Entry
104123879         CDS       T05152                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egz04131]
    104123879 (DOCK7)
Membrane trafficking [BR:egz04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    104123879 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 104123879
NCBI-ProteinID: XP_009634461
Position
Unknown
AA seq 2097 aa AA seqDB search
MSTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVPLTEAVDPIELEDYLTAHPIAV
ESGPLRDLLEFPPDDIEVVYTPRECRTLVSAVPEESEMDPHVRDCVRSYTEDWAIVNRKY
HKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNSYQDEQDDLKRRSMSIDDTPRGSW
ACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRKSSRHKELFALHPAPDEEEPIERL
SVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFYFDLNSEQMKG
MLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEPYMIFKESDAA
KNKEKLEKLKCQAEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDSTEVEVGTGERKG
SWSERRNSSIVGRRSLERTTSGDEACNLTSFRPATLTVTNFFKQEGDRLSDEDLYKFLAD
MRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVRPTREILEFPAR
DVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMPVIFGKSSCPEF
SKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQNTPLETPVGYTW
IPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFNVEVVAVSSLH
TQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSSQLEPVVRFLHL
LLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLDGNQDQHGRNSLLASYIYY
VFRLPNTYPNSPSPGPGGLGGSVHYATMARSAPTSPDDEVRSIIGSKGLDRSNSWVNTGG
PKAAPWGSNPSPSAESTQATDRSCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVV
CSGSVREAALQQAWFFFELMVKSMVHHLYFADKLDAPRKNRFPERFMDDVTALVSTIAGD
IVSRFQKDTEMVERLNTSLAFFLNDLLSIMDRGFVFALIKTCYKQVSSKLYSLTNPSNLA
SLRLDFLRIICSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFE
LSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRYADPQVK
ARVAMLYLPLIGVIMETVPQLYDFTESHNQRGRPSCVAVDDYESEGGSMISQTVAMAIAG
TSVPQLTRPSSFLLTSSSGRQHSTFSTESSRSLLICLLWVLKNADESVLQKWFTDLSVLQ
LNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSR
GQLERSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIIL
DTLEIVVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFE
EETEQCADLCLRLLRHCSSSIGTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSL
VGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQE
DPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSM
LEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAAS
FSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFR
VGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPVDKCKL
DPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRK
TILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMV
LQGSVGTTVNQGPLEVAQVFLAEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIG
PDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRWIFDFTLSAEIRRV
NT seq 6294 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgtagctgctgaagtcaggaagcagatctcagggcagtatggagggtctccc
cagcttctcaaaaacctcaatattggaggcagcgtctctcatcatacaactgtaccgctt
acagaagcagtggacccaattgagttggaggactaccttactgcacacccgattgccgtg
gagtctggacccctgagggacttgcttgagtttcctcccgatgacatcgaggtggtgtac
accccccgagaatgtcgaacacttgtgtcggctgtgcctgaagagagtgagatggaccct
catgtgagggactgtgtaagaagttacacggaagactgggcgattgtgaacagaaaatat
cacaagctaggaactggatttaatcccaacaccttagacaaacagaaggagaggcaaaag
gggctccccaaacagatctttgagtctgatgaagctccagacggcaacagttaccaggat
gaacaagatgaccttaaacgacgttcaatgtcgattgatgatactccccggggcagctgg
gcatgcagtatttttgatctgaagaactcccttccagatgcccttctcccaaacctactg
gaccgaaccccaaatgaagagattgaccaccacaatgaagatcagaggaagtccagtagg
cataaggagctttttgcactacacccagcaccagatgaggaggagcctatagaacgactt
agtgtccctgaagtacccaaagaacactttggccaaagactcctggtgaagtgtttgtcg
cttaagtttgaaatagaaatcgaacccatttttgcaagtttggctttgtatgatgttaaa
gaaaagaaaaagatatcagaaaatttctactttgatttaaactcggaacaaatgaaggga
atgcttcgtccacatgtgccccctgctgctatatccacactggccagatctgccatcttc
tctatcacttatccctctcaagatgtctttctggtaataaagctggaaaaagtattacaa
cagggagatattggggagtgtgcagagccttatatgatttttaaagaatctgatgcagca
aagaataaggaaaagttggaaaaactgaaatgccaggcagaacagttttgccaaagacta
ggcaagtatcgaatgccttttgcctggacagccattcatttaatgaacattgtgagcagc
gctggaagtttggaaagagattccacagaagtagaagttggcacaggagaacgtaaagga
tcgtggtcggagaggcggaattccagtattgttgggaggcgttcattagagagaactaca
agtggggatgaggcttgcaatttgaccagttttaggccagctactttgacagtgacaaac
ttctttaaacaggagggtgatcgcctgagcgatgaagatttgtacaagttccttgctgac
atgagacggccatcatcagtgttacggagattgagacctatcacagctcaattaaagata
gacatatctccagctccagagaatccccattactgtctgactccagagttgctgcaagtc
aaactttacccagacagcagagttagacctacaagagaaatcctggagtttcctgccagg
gatgtctacgttccaaataccacatacaggaaccttctttacgtgtatcctcagagcctt
aacttcgccaaccgccaaggatctgccaggaatatcacagtaaaagtccagttcatgtat
ggagaggacccaagcaatgctatgccggtcatctttggcaaatctagctgtcctgaattt
tccaaagaagcatacacagctgtagtatatcacaacagatcacctgattttcatgaggaa
atcaagattaagcttccagccactttaaccgatcaccaccacctgctttttactttctac
cacgtcagttgccaacaaaaacaaaacactcccctggagactccagttggatacacgtgg
ataccaatgcttcaaaatggacggttaaagactggtcagttctgcctacctgtttcgttg
gaaaaaccaccacaggcttattcagtgctttctccagaggttccactccctggaatgaag
tgggtggataaccacaaaggagttttcaacgtagaagttgttgctgtatcatccctgcac
actcaggacccttatctggacaagttctttgcacttgtccatgctctggatgagcacatg
ttccctgtgcgaataggagacatgagaattatggaaaacaacttggaaaatgaactgaag
agcagcatttcagctttaaattcctctcaactggagccggtagtgcgatttcttcatctc
ctgcttgacaaactgattcttctggtagtaagacctcctgtcattgcaggccaaatagtt
aacctgggccaagcatcgtttgaagcgatggcatcaatcataaacagacttcacaagaac
ttggacggaaaccaggaccagcatggcagaaacagccttctcgcttcctatatttattac
gtttttcgcctaccaaatacctatcccaactcaccatcaccaggtcccggtggcttaggg
ggatcagtgcattatgccaccatggctcgatctgctcccacctcaccagacgatgaagtt
cgctcgatcattggcagtaagggtttagaccgctccaattcctgggtaaacactggtggt
ccaaaagcagccccatggggatccaaccccagcccaagtgcagagtcaacacaggctacg
gatcgaagttgtaatcgtatgtcttcgcacactgagacgtcaagtttcttacaaacatta
acaggacgattaccaactaaaaagctttttcatgaagagctggccttacagtgggttgtg
tgcagcgggagtgtgcgggaggcagccctacagcaggcctggttcttcttcgagctgatg
gtgaagagcatggtgcatcatttgtattttgctgacaaactggatgcgccaagaaagaat
cgttttcctgagcgtttcatggatgatgtaactgctttggtcagcacaattgctggtgat
atagtctctcggtttcagaaggatacagaaatggttgaaagactcaacaccagtcttgca
ttttttctcaatgacctgttgtctatcatggacagaggatttgtttttgctcttattaag
acctgctacaaacaggtgtcttcaaaactgtattccttaacaaatccaagtaacctggca
tctttgaggctggacttccttcgcatcatttgcagccatgaacactacgtcaccttgaat
ttaccctgcagcttgctcacaccgcctgcatctccatcaccatctgtgtcttcagcaact
tctcagagttctgggttctccacaaatgtccaagaccagaagattgcaaatatgtttgaa
ttgtctgtgcctttccgccaacagcattacttggccgggcttgtgttaacagaactggct
gtcattttagatcctgatgcagaaggtttatttggattgcataagaaggtcatcaatatg
gtacacaatttactgtccagtcacgactcagatccgcggtacgctgacccacaggtaaag
gcccgggtggcaatgctgtatctacctctgattggcgtgatcatggaaaccgtgcctcag
ctttatgactttacagagagtcacaatcagcgagggaggccaagctgcgtcgctgttgat
gattatgaaagtgagggtggaagcatgataagccaaacagttgccatggccatcgcagga
acatcggtccctcagctcacccggcccagcagttttctacttacctcatcgagtggcagg
cagcactccaccttctcaacagagtccagccgcagccttctgatctgtctcttgtgggtg
ctcaagaacgcagatgaaagcgtcttgcagaaatggttcacagacctgtcagtattgcag
ctcaatcgcctgctggatttgctttatctttgcgtatcctgctttgaatacaagggcaag
aaagtatttgaaagaatgaacagtctgacattcaagaagtcaaaagacatgagagccaaa
cttgaagaagctattttgggaagcataggggcaaggcaggagatggtccgaagaagcaga
ggacagctagagagaagtccttccgggagcgcatttggaagtcaagagaatttgaggtgg
agaaaggatatgactcactggcgtcaaaacacagaaaagcttgacaaatcaagggcagag
atagaacacgaggcacttattgatggaaatcttgcaacggaagcgaatctgattattttg
gatacactagagatagttgtacagactgtttctgtgacggaatccaaagagagtatcctc
ggtggggtgctgaaagtgcttctgcacagcatggcctgcaaccaaagtgcactttatctc
caacactgcttcgccacacagagggctttggtttcaaagttccctgagctgctgtttgaa
gaagagactgagcagtgtgcagatctgtgcctgaggctcctgagacactgtagcagcagt
atcggcacgatacggtcgcatgcaagtgcctctctttaccttctaatgaggcaaaacttt
gagattgggaacaactttgccagagtgaaaatgcaggtgaccatgtctctctcatccctg
gtggggacatcccagaacttcaatgaggaatttttgcgacgttccctgaaaactattttg
acatatgctgaagaagatctggaacttagggagacaacatttcctgatcaggtccaggat
ctagtgttcaacctccatatgatcctctctgacacagttaaaatgaaggagcaccaggaa
gatccagaaatgctgattgacctgatgtacaggattgcaaagggctatcagaattcccct
gacctgcgcctgacgtggctgcagaacatggctggaaagcactccgagaggagcaatcat
gccgaatcagcccagtgcctggtccactctgcagccttggtggctgaatatctaagcatg
ctggaagaccgaaaatacctccctgtagggtgtgttacttttcagaacatatcttcgaat
gttttggaagaatcagcagtttctgatgatgttgtatcaccagatgaagaaggtatctgt
tctggaaagtattttacagaagctggtctggtgggattgctggaacaggctgcagcatct
ttctccatggctggcatgtatgaagcagttaacgaggtttacaaagtccttattcctatt
catgaagctaatagagatgccaagaagctatctactattcatggtaaactccaagaagca
ttcagcaagattgttcaccagagtactggctgggagaggatgtttggcacctacttccgg
gttggtttttatggaactaaatttggagacctggatgagcaagagtttgtttacaaggaa
cccgcgataacaaaactagctgaaatttcccataggcttgagggattttacggagaacgg
tttggtgaagatgtgcttgaagtcataaaggactcaaaccctgtggacaaatgtaaacta
gatcctaacaaggcctacattcagataacctatgtggagccgtactttgacacatatgag
atgaaggacaggataacttacttcgacaaaaactacaacttgcggcgtttcatgtactgc
acgcccttcacactggatggccgagctcatggggagctgcatgagcagttcaagcgtaaa
acaatcctgacgacatcccacgctttcccttacattaaaaccaggataaacgtcatccac
aaagaggagatcattttgacacccattgaagttgccatagaggacatgcagaagaaaaca
caggaattggcttttgcaacccaccaagaccctgcagacccaaagatgctgcagatggtg
ctacaaggatcagtaggtaccacagtaaatcagggaccactagaagttgcacaagttttc
ttggctgagatacccaatgatccaaagctcttcagacatcataacaagctacggctctgt
ttcaaagacttcacgaaaagatgtgaagatgctctgcgcaagaacaagagcctgattggt
ccagaccaaaaggagtatcagcgagaacttgaaaggaattatcaccggttaaaggaagct
ctccaacctttgataaatagaaagatcccacagttgtataaggcagtgctgccggtcact
tgccacaggtggatatttgattttactctttcagcagagataaggagggtgtaa

DBGET integrated database retrieval system