KEGG   Egretta garzetta (little egret): 104124105Help
Entry
104124105         CDS       T05152                                 

Gene name
XPO5
Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
egz  Egretta garzetta (little egret)
Pathway
egz03013  RNA transport
Brite
KEGG Orthology (KO) [BR:egz00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    104124105 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:egz03016]
    104124105 (XPO5)
   03036 Chromosome and associated proteins [BR:egz03036]
    104124105 (XPO5)
Transfer RNA biogenesis [BR:egz03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    104124105 (XPO5)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     104124105 (XPO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N Sec3_C
Motif
Other DBs
NCBI-GeneID: 104124105
NCBI-ProteinID: XP_009634709
Position
Unknown
AA seq 1158 aa AA seqDB search
FNCVCVSSVLPQFCEEFKEKCPICVPCGLKLAEKTQTAIVRHFGLQILEHVVKFRWNNMP
RLEKVYLKNNVMGLISSGTQSILEEESHIKDVLSRIVVEMIKREWPQHWPDMLKELDTLS
KQGETQTELVMFILLRLAEDVVTFQTLPTQRRRDIQQTLTQNMEKIFSFLLTTLQQNVNK
YRRMKADLAQEPKAQANCRVGIAALNTLAGYIDWVALSHITADNCKLLEMLCLLLNEPEL
QIGAAEFLKFGKLEDRKPLMVLFGDVAMHYILSAAQTADGEGLVEKHYVFLKRLCQVLCA
LGSQLCALLGSDSDVETPTNFGKYLDSFLAFTTHPSQFLRSSTQITWGALFRHEVLSRDP
LLLAMIPKYLRASMTNLVKVGFPSKTDSASCEYSRFDFDSDEDFNAFFNSFRAQQGEVMR
MACRLDPRTGFHMAGEWLKYQLTAPVDTGPMNSKTGEGLCSIFSPSFVQWDAMTFFSESV
ISQMFRTLDKDEIPVNDGIDLLQLVLNFETKDPLILSCVLTNVSALFPFVTYRPEYLPQV
LSKLFASVTFEVIEESKFVMSVQAPRTRAVKNVRRHACSSIIKMCRDYPQLVLHVKQLLS
NELLLTQMEKCALMEALVLISNQFKDYERQKAFLEELMAPVAGLWLSPEMQRVLSDPEAF
ISYVGADNKIADPVISFCVYTILGVVKRARWPAATEEAKAGGFLVGYMPSGSPIYRNPCT
EQVLKLLDNLLALIRTHNNLYMPEMVARLGETFAKALDMLEVEKNAILGLPQPLLELYDS
PVYKTVLERMQGFFCTLYDNCFHILGNAGPSMQQDFYTVEGLATQLLSSAFINLNNIPDY
RLRPMLRVFVKPLVLSCPSEYYETLVCPMLGPLFTYLHMRLSQKWQVINQRSMLCEDDAA
DDNPESQEMLEEQLVRLLTREVMDLITVCCVSKKGVEHNTTAAVDGDDDEAMATEVTPPT
SAELTELGKCLMKQEDVCTALLITAYTSLSWKDTLSCQRTTTQLCWPLLKQVLPGNLLPD
AVSWFFTSVLKGLQTHGQHDGCMAALVHLAFQIYEALRPRYAELKAVMEQIPDIQRDSLE
QFDSKLLNPTLQKVADKRRKDHFKRLITGCIGKPLGEQFRKEVHIRNLPSLFKKVKPSLE
TDVLENEDGEGLTALFEP
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
tttaactgcgtgtgcgtgtcctcggtccttccccagttctgcgaggagttcaaggagaag
tgccccatctgtgtgccctgtgggctgaagctggcggagaagacgcagacggccatcgtc
cggcacttcggcctgcagatcctggagcatgtggtcaagttccgctggaacaatatgcct
cgcctagaaaaagtttatctaaagaacaatgtcatgggcctcatatccagtggaactcag
agtattctggaggaggaaagtcacattaaggatgttctgtctcgcattgtggtggagatg
atcaagcgtgaatggccccagcactggcctgacatgctgaaggagctggataccctctcc
aagcaaggggaaactcagacagaactggtgatgttcatcctcctacgtttggcagaggat
gtggtgacttttcaaactctgcctacccagcgacgacgagatatccagcaaaccctcacc
cagaacatggagaagatcttcagcttcctactaactaccttgcagcagaacgtcaacaag
tacaggcgcatgaaggctgatctggctcaggagccaaaggcccaggcaaactgccgcgtg
gggatagcagcactcaacaccttggctggctacattgactgggtggccctgagccacatc
acagcagacaactgcaagctcttggagatgttgtgtctgctcctaaatgaacctgagctc
caaataggagcagcagagtttttgaagtttggtaagctggaggatcgtaagcctctgatg
gtcttgtttggagatgttgccatgcactacattctctctgctgcccagacagcagatgga
gaaggcctggtggagaagcactatgttttcttgaagagactttgccaagttttgtgtgcg
ttgggcagccagctatgtgcgttgctaggctcagattctgatgtggagacgccaaccaac
tttggaaagtaccttgactcctttttagccttcacaacccatcccagccagtttctgcgc
tcttccacccagatcacatggggagccctctttcggcacgaagttctgtctcgcgacccc
ttgctgctggctatgattcccaagtatctccgtgcatctatgaccaacctagtgaaggtg
ggctttccctctaaaacagacagtgccagttgtgaatactcccgctttgattttgacagt
gatgaggacttcaatgccttcttcaactctttccgagcccagcagggggaggtgatgagg
atggcttgtcgtctggatccccgaactggcttccacatggctggtgaatggctgaagtac
cagctcacagctcctgttgatactggacccatgaactctaagacaggcgaaggtctctgc
tccatcttctctccgtcctttgtgcagtgggatgccatgaccttcttctcagagagcgtc
atcagccagatgtttcgaaccctggataaagacgaaatcccagtgaacgatggcatagat
ctgctgcagcttgtccttaattttgaaacaaaggatcctctcatcctgtcctgtgtgctc
accaatgtctctgctctcttcccatttgtcacttaccgaccagaatacctaccgcaagta
ctttccaagctgtttgcttcagttacctttgaagttatagaagaaagtaagtttgttatg
tctgtccaggctcctagaactcgagcagtgaagaatgtgagaaggcatgcgtgctcctca
atcataaagatgtgtcgggattaccctcagcttgtcctgcacgtgaagcaactgctctcc
aatgagctacttctgacacagatggagaagtgtgctcttatggaggccctcgtcctcata
agcaaccagttcaaagactacgagcggcagaaagctttcctggaggagctcatggctcct
gttgctggcttatggctttccccagagatgcagagagtcctctcggatcctgaagccttt
atctcctatgtgggtgcagacaacaaaatcgccgatccagtcataagcttttgcgtgtac
accattctgggagttgtgaaacgagctcgttggcctgcagctactgaagaggcaaaagct
ggaggattcttggtgggatacatgcccagtggaagtccaatctaccgtaatccctgcact
gaacaggtcctgaagcttcttgacaacttacttgctcttataaggactcacaacaatctc
tacatgccagagatggtggctaggctgggggaaacgtttgcaaaggccttagacatgctg
gaggtggagaagaatgccatcctaggtctccctcagcctctgctggagctttatgactct
cctgtttacaaaacggtcttagaaaggatgcagggcttcttttgtaccctctacgacaac
tgtttccacatcctgggaaatgcaggcccctccatgcaacaggatttctacaccgttgag
ggtcttgccacccagctcctcagctcagctttcatcaacctcaacaacattcccgattac
agactgcgtcccatgctccgtgtgtttgtgaagcccttggtactctcctgcccttcagaa
tactacgaaacccttgtctgccccatgctgggaccactctttacctatctgcacatgagg
ttgtctcagaaatggcaggtgatcaaccagcgaagcatgctctgtgaggatgatgctgca
gatgacaaccctgagtctcaggagatgcttgaggaacagctggtcaggctgctgacccga
gaagtcatggatctcatcactgtttgctgtgtttctaagaaaggcgttgagcataacact
actgctgctgtagacggagatgatgatgaggcgatggccacggaggtgactccccctacg
agcgcagagctcaccgagctcggcaagtgtctgatgaagcaggaggatgtttgcactgcg
ctgctgatcactgcctacacatccctctcctggaaggacaccttgtcctgccaaagaacc
acaacacagctttgctggccgctgctcaaacaggttcttccaggaaacctcctccccgat
gctgtgtcctggtttttcacaagtgtgctgaagggcttacagacacacgggcagcacgat
ggctgcatggcagcgcttgtccacctggctttccagatctacgaggccttgcgccctcgc
tacgctgagctgaaggcagtgatggagcagatcccagacatccagagggactctttggag
cagtttgattcaaagcttctcaacccaacactgcagaaggtggcagacaagcgccggaag
gatcatttcaagcgcctcatcacaggttgcattgggaagcccctcggggagcagttccgc
aaggaggttcatatccggaacctcccatctctcttcaaaaaggtgaagccatcattggag
acggatgtgctagaaaatgaggatggagagggcctcactgcactctttgagccctga

DBGET integrated database retrieval system