KEGG   Egretta garzetta (little egret): 104124554Help
Entry
104124554         CDS       T05152                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00564  Glycerophospholipid metabolism
egz00565  Ether lipid metabolism
egz00590  Arachidonic acid metabolism
egz00591  Linoleic acid metabolism
egz00592  alpha-Linolenic acid metabolism
egz01100  Metabolic pathways
egz04010  MAPK signaling pathway
egz04217  Necroptosis
egz04270  Vascular smooth muscle contraction
egz04370  VEGF signaling pathway
egz04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104124554 (PLA2G4A)
   00565 Ether lipid metabolism
    104124554 (PLA2G4A)
   00590 Arachidonic acid metabolism
    104124554 (PLA2G4A)
   00591 Linoleic acid metabolism
    104124554 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    104124554 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104124554 (PLA2G4A)
   04370 VEGF signaling pathway
    104124554 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104124554 (PLA2G4A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104124554 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104124554 (PLA2G4A)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104124554 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 DUF2281
Motif
Other DBs
NCBI-GeneID: 104124554
NCBI-ProteinID: XP_009635209
Position
Unknown
AA seq 749 aa AA seqDB search
MSVIDPYQHIVVEHQYSHIFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPSAPDCRKRT
KHFNNDVNPVWNETFEFILDPNQENVLEVTLMDANYVMDETLGTSTFPISSLKLGEKKEV
QLTFNDVTEMTLELSLEVCSSTDLRFSMALCDEEKKFRQQRKDNIMHSMKSFLGEENSKN
LTTSRDVPVIAILGSGGGFRAMVGFAGVMKALYESGILDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPKEINEELMNSVSHNPLLLLTPQKVKRYIEALWNKKSSGQPVTFTDIFGMLIG
ETLIHNRMDTTLSNMKEKINNAQCALPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMSPDLFGSKFFMGTMVKKYSENPLHFLMGVWGSAFSILFNRVLGVSNSQNKGPTMEEE
LENIRLKHLVSNDSSDSEDESQHPKGTENAEANQEYQNSSQESWVQRMLMALVGDSALFN
TREGRAGKVHNFMLGLNLNSCYPLSPLADLLTQESVEEDELDTAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKEILLAEKWAKMN
KLPFPKIDPNVFDRDGMKECYVFKPKDTSSEKDCPTIIHFVLANINFRNYKAPGVPRETQ
EEKDFADFDIFDDPNTPFSTFNFQYPNEAFKRLHDLMEFNTLNNIDVIKQAMMESIEYRK
ENPSRCSVSLSSVEARRFFNKNNLNNNHT
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcatagatccttatcaacacattgtggtggaacaccagtattcacacatattc
actgtgacagtaaggaaagccacaaatgtcacaaaaggagcgattggtgacatgcttgac
actccagatccgtatgtggagctgttcatcccatctgcccctgattgcaggaagagaaca
aaacatttcaataacgacgtgaatcctgtgtggaatgagacctttgagttcattttggac
cccaaccaagagaatgttcttgaggttactttgatggatgccaactacgttatggatgag
actcttggcacatccacatttcctatatcttctctgaaattgggagagaagaaggaggtc
cagttaactttcaatgatgtcacagaaatgactttggaattgtctcttgaagtatgctct
tcgactgatctccgattcagcatggctttgtgtgatgaggagaagaaatttcggcaacag
cgaaaagataatatcatgcacagtatgaagtcatttctaggagaggaaaacagcaaaaac
ttgaccacttcccgtgatgtgccagtgatagcgatattgggttcaggaggtggatttcgt
gccatggtagggtttgctggagtcatgaaagcactttatgaatcaggaattttagactgt
gcgacttacattgctggtctctcaggatccacgtggtacatgtcgactttgtattcacac
ccggattttccagaaaaaggaccaaaggagattaatgaagaattgatgaactctgtgagt
cacaacccacttctgctgctcacccctcagaaagtcaaacgctacattgaagcactgtgg
aataagaaaagctcaggccagcctgtcaccttcacagatatctttggaatgctaataggt
gaaacacttatccataatagaatggacaccactttgagcaacatgaaagaaaaaatcaat
aatgcacagtgtgcgctcccactctttacatgtctccacgtcaaaccagatgtctcagag
ctgatgtttgcagactgggtggaattcagtccgtatgagattggtatggcaaagtatggc
acttttatgtctcctgatttgtttggaagcaaattttttatggggacaatggtgaagaag
tatagtgaaaatcccttgcatttcttgatgggtgtctggggcagtgcattttctatatta
tttaacagagtgcttggtgtctccaactctcaaaataaaggtcccaccatggaagaagaa
ttagaaaacattaggctaaagcaccttgtaagcaatgacagttcagacagtgaagatgaa
tcacagcatccaaaaggtactgaaaacgctgaagcaaatcaagaatatcagaacagcagc
caagaaagctgggtgcagcggatgctgatggctttggtgggtgatagtgcccttttcaac
accagggaagggcgtgctgggaaagtgcacaactttatgctgggattgaacctcaacagc
tgttacccactctctcctctggcagaccttcttactcaggagtccgtggaggaagatgaa
ctagatacagccgttgcagatcctgatgagtttgagaggatatacgagccactagatgtg
aagagcaaaaagattcatgtagtggacagtgggcttacctttaacctgccgtacccactt
atcttaagacctcaaaggggcgttgatctcatcatctcttttgatttttcagcaaggcca
agtgattccagtcctcctttcaaagaaattttgcttgctgaaaaatgggctaaaatgaac
aagcttcctttcccaaaaatagacccaaatgtatttgatcgagacggcatgaaggagtgc
tatgttttcaaaccaaaggatacctcttcagagaaagactgcccaacaataattcatttt
gttttggccaacatcaacttccggaattacaaagctccaggagttccaagagaaacacaa
gaagagaaggattttgcagactttgacatttttgatgatccaaatacaccgttctctacc
ttcaacttccagtatcccaatgaggctttcaagaggcttcatgatctgatggagttcaac
accctcaataacatagatgtgatcaagcaagctatgatggaaagcattgaatacagaaaa
gagaatccatctcgctgctccgtgtctcttagcagtgttgaagcaaggagattctttaat
aagaacaatcttaacaacaaccatacatag

DBGET integrated database retrieval system