KEGG   Egretta garzetta (little egret): 104124816Help
Entry
104124816         CDS       T05152                                 

Gene name
ACAT2
Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00071  Fatty acid degradation
egz00072  Synthesis and degradation of ketone bodies
egz00280  Valine, leucine and isoleucine degradation
egz00310  Lysine degradation
egz00380  Tryptophan metabolism
egz00620  Pyruvate metabolism
egz00630  Glyoxylate and dicarboxylate metabolism
egz00640  Propanoate metabolism
egz00650  Butanoate metabolism
egz00900  Terpenoid backbone biosynthesis
egz01100  Metabolic pathways
egz01200  Carbon metabolism
egz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    104124816 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    104124816 (ACAT2)
   00640 Propanoate metabolism
    104124816 (ACAT2)
   00650 Butanoate metabolism
    104124816 (ACAT2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104124816 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    104124816 (ACAT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104124816 (ACAT2)
   00310 Lysine degradation
    104124816 (ACAT2)
   00380 Tryptophan metabolism
    104124816 (ACAT2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    104124816 (ACAT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egz04147]
    104124816 (ACAT2)
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     104124816 (ACAT2)
Exosome [BR:egz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104124816 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 104124816
NCBI-ProteinID: XP_009635487
Position
Unknown
AA seq 346 aa AA seqDB search
MGQNKGKLLPVPAGAGQNPVRQASVAAGIPYSVPAWSCQMICGSGLKAVCLAAQSILTGD
SSIVVAGGMESMSKAPHVIHMRAGVKMGEASLQDTVILDGLTDAFYQYHMGITAENVASQ
WQVSRGEQDQFAVQSQNKAEAAQKAGYFTKEIVPVLVPSKKGPIEVKTDEHPRHGSNLET
MAKLKPCFLTDGTGTVTAANASGINDGAAAVILMKKSEAARRGLMPLARIVSWAQTGIDP
SIMGVGPISAIKKAIDKASWTLEQVDLFEINEAFASLSVAIAKELKVNPEKINIQGGAIA
LGHPLGASGCRILVTLLHALERTGGKRGVAALCIGGGMGIAMCVER
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaacaaaggaaaattgctgcctgttcctgcaggtgccggccagaaccccgtc
cggcaggcgagcgtcgctgcgggaatcccttactctgtgcccgcctggagctgccagatg
atctgcgggtcaggcttgaaagcggtatgtctggctgctcagtccatactgacgggagac
tccagcatcgtggtcgcgggaggcatggaaagtatgagcaaggctcctcatgtaattcac
atgcgagctggggtgaaaatgggagaggcttccttgcaggacactgtaatccttgatggc
cttacagacgctttttatcagtatcatatgggtataacagctgaaaatgtggccagtcag
tggcaggtcagcagaggggaacaagaccagtttgctgtacagtcgcaaaacaaggcagag
gcagcacagaaagctggctattttacaaaagaaattgttcctgttcttgtaccttctaaa
aaaggtcctatagaagttaaaacagatgaacaccctcgacatgggagcaacttggaaaca
atggcaaagttaaagccctgtttcctgacagacggaactgggacggtgacagcagctaat
gcttcaggtataaatgatggagctgcagctgtaattctaatgaagaagtcggaagctgct
aggagaggtcttatgcctttggctcggattgtatcttgggctcagacaggtatagatcca
tctataatgggagtagggcccatttcagcaataaagaaagctattgacaaagccagctgg
actctggaacaagttgacctgtttgaaattaatgaagcctttgcatcgctatctgttgca
atagcaaaagaactgaaagtaaatccagaaaagattaatatccaaggtggagccattgcc
cttggccaccctcttggtgcctctggttgtcgcatccttgttactcttctacatgcactg
gaacgaacgggtggaaaacgcggtgttgctgctctctgtatagggggcggaatgggaata
gccatgtgtgttgagagatga

DBGET integrated database retrieval system