KEGG   Egretta garzetta (little egret): 104124847Help
Entry
104124847         CDS       T05152                                 

Gene name
CDK13
Definition
(RefSeq) cyclin-dependent kinase 13
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egz01001]
    104124847 (CDK13)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104124847 (CDK13)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     104124847 (CDK13)
Protein kinases [BR:egz01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104124847 (CDK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104124847
NCBI-ProteinID: XP_009635517
Position
Unknown
AA seq 1127 aa AA seqDB search
RSAKSRSRSPYSSRHSRSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEA
AKASAKASNTSTPTKGSTDTAVSAPQVNNVKDLKKIKTEHTPSPTSSANLKNDKAKAKVS
LPEAKAENNLIADKITKQKPTAVKENKLTVVKQPPATVKEKNKPSTPSVVTKEKDRIVAL
PTSTLPPLPLPPTLPEDKETDSLRENLSVKSVKEAEKKLRHLLADLPLPPELPGGADLSK
SPEEKKPAVQSHSKRRPKICGPRHGETKEKEIDWGKRCVDKFDIIGIIGEGTYGQVYKAR
DKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLNHQSIINMKEIVTDKEDALDFKKD
KGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLAYCHKKNFLHRDIKCSNI
LLNNRGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCI
LGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLAYFNTMKPKKQYRRKLREE
FAFIPPAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSK
KRRRQKQMGMTDDSTATKVPRKDLSLGMDESRTNTPQGMQTSSQLKTQGNSSVALAKTST
GQQLNQNEVAILLNLLQSKTSVSLAQFAQVLNIKVNPETQQQLNKINLPAGILSAGEKQS
EQQQQPPPPPPPPPEQEPLKQPAVTQPPVPPAQLSQPKVETDAAQAAVQSAFAVLLSQLI
KAQQTKQKDFVLEEKENGSGNEMSLQLRQPPEPTTPVSVSRDDVESPAPGYPHLIKSLYT
SAGQEDLVRQSEMRLLNRTPEQERPRILPPDQRPPEPPEPPPLTDEDLDYRTENQHLPIT
NSSGTDPHAGVKAALLQLLAQHQAQATTEEPVQTSVDYQARESYVTGPDYKDNFGSSSFS
SAHYGSSDGIGSGSSGALERRSFLGNSDIQSLDNYSTASSHSGGAPPPSAFSESFPSSVT
GYGDIYLNTGPMLFSGDKDHRFEYSHGPIPVLGSSSDASAGPESTHSLPTKMHNYSYGSN
LQENPGGISHMHGQTWTSPAQGPGYSQGYRGHISTSAVRGRGRGLPY
NT seq 3385 nt NT seq  +upstreamnt  +downstreamnt
gagatcagcaaaatctcggagcagaagtccatattcatcaaggcactcgaggtctcgtag
cagacacagattgtctagatccagaagtcgtcattcaagtatttctcctagtacattgac
tctgaagagtagcctggctgctgagctgaacaaaaacaaaaaagcaagagctgctgaggc
agccaaagccagtgcaaaagcttccaatacttcgacacctactaagggaagcactgacac
tgctgtaagtgcacctcaagtgaacaatgtaaaggacctgaagaaaataaaaactgagca
tacgccttctcctacaagcagtgcaaatttgaaaaatgacaaggcaaaagcaaaggtctc
acttcctgaagcaaaagcggaaaataatttaattgcagacaaaattactaagcagaaacc
tacagcagtaaaagagaataaattaactgttgtaaaacagccaccggccactgtaaaaga
gaaaaacaaaccgagtacaccaagtgtagtaaccaaggagaaggaccgaattgttgcact
accaacctccacactgccacccttgcctttgcctcccacgctgcctgaagataaagaaac
tgatagtttgcgagagaatctttctgtgaagtcagttaaagaagcagagaagaaacttcg
ccatctgcttgcagacttgccacttccacctgagttgcctggaggagctgacttatccaa
aagtcctgaagaaaagaaaccagcagttcagtcacacagcaagagaagaccaaaaatatg
tggaccacgacatggtgaaacaaaagaaaaagaaatagactggggaaagcgctgtgtgga
taaatttgatatcattggtattattggtgagggcacttacgggcaagtttacaaagccag
agataaagacacaggggaaatggtggcactaaagaaagtacgtctggataatgaaaagga
agggtttccaattacagctattcgggagattaagattcttcgacagcttaatcaccaaag
cattatcaacatgaaggaaatagtgacagataaggaagatgctttggacttcaagaagga
caaaggtgcattttacctggtatttgagtacatggaccatgacttgatgggactgctgga
atctggtttggttcattttaatgaaaatcatattaaatctttcatgagacagctgatgga
gggcttggcctattgccataagaagaactttttgcacagagatatcaaatgttcaaatat
tctgctaaataatagagggcagataaagcttgcagattttgggcttgctcggctgtacaa
ctctgaagaaagccgaccatataccaacaaagttattacattatggtatcggcctcctga
acttctgctcggagaagaaagatacacaccagctatcgatgtctggagctgtggctgcat
cttgggtgaactttttacaaaaaagccaatatttcaagcaaatcaagaacttgctcaact
ggaacttataagccgaatttgtgggagtccttgtccagcagtgtggcctgatgttataaa
attagcttatttcaacacaatgaaaccaaagaagcagtatcgtcgaaaactgagagaaga
gtttgctttcatcccaccggctgcattagatttattcgattacatgcttgctctggatcc
aagcaagcgctgcacggctgaacaagctcttcagtgtgagtttctgcgagatgtggaacc
atctaaaatgcctcctccagaccttcctttgtggcaggattgccatgagctgtggagtaa
gaaacgcagaagacagaagcagatgggcatgactgatgactcaacagcaactaaagtccc
taggaaggatctctctctaggcatggatgagagcagaaccaacaccccacaaggcatgca
aacttcttcccaactcaaaactcagggcaactctagtgtagcacttgcaaaaacaagcac
tggacaacagttaaaccagaatgaagtggcaatcctgctaaacctgctacagtctaaaac
aagtgttagtttggcacagtttgcccaagtgttgaatattaaggttaacccagagactca
gcagcaactaaataaaataaatcttcctgctggaattttgtcagcaggtgaaaaacagtc
agaacagcagcagcagccgccgccgcctccaccaccaccgccggaacaggagcctctaaa
acagccggccgtcacgcagcctcctgtaccacctgctcagctgagtcagcctaaagttga
gactgacgctgcccaggcagctgtacagagtgcatttgctgttctgttgtctcagttaat
aaaggctcagcaaacaaaacaaaaagattttgtgttggaggagaaggaaaacggatcagg
aaatgaaatgtcgttacaactcaggcagcctccagagcccaccactcctgtgtctgtcag
ccgggacgacgtggaatctccagctcccggctacccccatctgatcaagtcattatacac
gtctgcaggtcaagaggatttggttaggcagtccgagatgaggcttctcaaccgaacacc
cgaacaagaacgccctcggatcttgcctccggaccagcgtcccccagagccaccggagcc
tccgcctctcactgatgaagaccttgattatcggacagagaaccagcatttgcctataac
taactcttcaggaacagaccctcacgcaggagtgaaagcagctcttctgcagctgcttgc
tcagcatcaagctcaggcgacaacagaggagccggtacaaacaagcgtggattatcaggc
tagagaatcctacgtaacaggcccagactacaaggataactttggatcatcttccttctc
atctgcccattatggcagtagcgatggaataggaagcggatcatcaggagcattagaaag
gaggagcttccttggaaattcagatattcagtctttggataactacagtactgcttcatc
tcactctggcggtgcccctcctccgtcggccttttcagaatcctttcccagctcagtaac
tggttatggagacatttacctcaacactggccccatgctatttagtggagataaagacca
taggtttgaatacagccacggcccaatcccggttctgggaagcagcagtgatgcttccgc
agggccagagagtacgcactctttgcccacaaagatgcacaactatagctacggaagtaa
cttacaggaaaatcccggtggcatcagccacatgcatggacagacttggacttctccggc
ccaaggacccggctattcccaaggatacaggggacacattagcacatctgcagtgagagg
gcgaggcagaggattaccatattga

DBGET integrated database retrieval system