KEGG   Egretta garzetta (little egret): 104125133Help
Entry
104125133         CDS       T05152                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00010  Glycolysis / Gluconeogenesis
egz00562  Inositol phosphate metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104125133 (MINPP1)
   00562 Inositol phosphate metabolism
    104125133 (MINPP1)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104125133 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104125133 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 104125133
NCBI-ProteinID: XP_009635835
Position
Unknown
AA seq 263 aa AA seqDB search
MRFFDHCAKFVALVEENEAAMYQVNAFKEGPEMRKVLEKVASALCLPVEELNADLVQVAF
LTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRSSCILFQDIFQ
HLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGFFKDDEPLKANNYVRQTHRKFRS
GQIVPYAANLVFVLYHCDQVKTSKEEYQVQMLLNEKLMSFHHSNETISTYADLKDYYKDI
LENCHFKDECELPKVNITAVDEL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttttcgatcactgcgccaagtttgtcgccttggtggaagagaacgaggcggcg
atgtaccaggtgaatgccttcaaagaggggccggagatgaggaaggtcttggagaaggtt
gcgagtgccttgtgcttgccagtggaggagctgaacgcagaccttgttcaagtggctttt
ctcacctgctcatacgagttggctataaaaaatgtgacctccccgtggtgctcgctcttc
agtgaagaagatgccaaggtactggaatacctgaatgacctgaagcaatactggaagaga
ggatatggctatgacatcaatagtcgctccagctgcattttattccaagatatcttccag
catttggacaaagcagtggaagagagcaaaagttcaaaacccatttcttcacctttgatt
gtacaagttgggcatgcagagacacttcagccactgcttgcccttatgggtttcttcaaa
gatgatgagcctctcaaggcaaacaattacgtcagacaaacgcatcggaaattccgcagt
ggccagatcgtgccttatgcagccaacctggtatttgtgctttaccactgcgaccaagtg
aaaacctctaaagaagagtatcaagtgcagatgctgttgaatgaaaaactgatgtcgttt
catcactcaaatgaaaccatctctacctacgcggacctcaaggactattacaaggacatc
ctggaaaactgccacttcaaagacgagtgtgaattaccaaaagttaatattactgctgtt
gatgagctttga

DBGET integrated database retrieval system