KEGG   Egretta garzetta (little egret): 104125173
Entry
104125173         CDS       T05152                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00230  Purine metabolism
egz00240  Pyrimidine metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104125173 (DCK)
   00240 Pyrimidine metabolism
    104125173 (DCK)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104125173 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 Thymidylate_kin AAA_18 AAA_33 DUF5066 BCAS3
Other DBs
NCBI-GeneID: 104125173
NCBI-ProteinID: XP_009635879
Position
Unknown
AA seq 270 aa
MAAALWVSDPRVRIPSLSLPPAFSAPTRHPQAPRTGAAGKSTFVNLLKQADEEWEVVPEP
VARWCNVQQNSEDDCEELTSSQKGGRNVLRMMYEKPERWSFTFQTYACLSRIRAQLRSLD
GKLREAENPVVFFERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGPSLALD
GIIYLRATPEKCLNRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFEYLQEIPI
LTLDVNEDFKGKKDRYDHMTEKVKEFLSTL
NT seq 813 nt   +upstreamnt  +downstreamnt
atggctgcagcgctctgggtttccgaccctcgggtccgcatcccttccctcagcctgccc
cccgccttctcagctcccacccgtcacccccaggcaccccgtaccggggctgcagggaag
tcgacgtttgtgaatcttctcaagcaagccgatgaggaatgggaagtcgttccggagcct
gtagctagatggtgcaatgttcagcaaaactctgaagacgattgcgaggagctgacttca
tcgcagaagggtggcagaaacgtgcttcggatgatgtatgagaaaccagagaggtggtct
ttcactttccagacctacgcgtgtctcagcaggatccgggctcagctccgatccctcgat
ggcaaactcagagaggcggagaatcctgtggtcttctttgagcgatctgtttacagcgac
agatatatctttgcagctaatttatatgagtctgattgcatgaatgaaactgaatggact
atttaccaagactggcatgactggatgaataagcagtttggtccaagcctagcgctggat
gggatcatttatctcagagccactcctgagaaatgcttaaataggatttacttgcgtgga
agagatgaagagcaagaaattcctattgaatatctggagaagcttcactacaaacatgaa
agttggcttcagcataggacgctgcggacggattttgaatatctacaggaaatacctatt
ttaacgttagatgttaatgaagacttcaaaggcaaaaaggacagatatgatcacatgact
gaaaaggtcaaagaatttttgagcacgttataa

DBGET integrated database retrieval system