KEGG   Egretta garzetta (little egret): 104127577Help
Entry
104127577         CDS       T05152                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00564  Glycerophospholipid metabolism
egz00565  Ether lipid metabolism
egz00590  Arachidonic acid metabolism
egz00591  Linoleic acid metabolism
egz00592  alpha-Linolenic acid metabolism
egz01100  Metabolic pathways
egz04010  MAPK signaling pathway
egz04217  Necroptosis
egz04270  Vascular smooth muscle contraction
egz04370  VEGF signaling pathway
egz04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104127577
   00565 Ether lipid metabolism
    104127577
   00590 Arachidonic acid metabolism
    104127577
   00591 Linoleic acid metabolism
    104127577
   00592 alpha-Linolenic acid metabolism
    104127577
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104127577
   04370 VEGF signaling pathway
    104127577
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104127577
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104127577
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104127577
Enzymes [BR:egz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104127577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 104127577
NCBI-ProteinID: XP_009638553
Position
Unknown
AA seq 808 aa AA seqDB search
MGSYWSAHESEECPCCLLSVKIVRMRNLRKADMFTQTDCYVSLSLPTASPKTVRTKTIKN
CRDPVWNETFCFRIQSQVKNILELKVYDENAITEDDLLFTVLFDVAKIQLGETVHLTFQL
NPKTQEMLEVEFASESIPVSPEKLVTNGVLVSREISCLEVLVDNKQTKNEPSEKDFLFSV
KGSYEESQTLSLGSPQRPAEPLHFHYIKYSLSELCMALAEKKPHFCSCTSGEEKKDCHAS
LTIPLDSLPFKEKVAVAKDETINLHVKSNNWSRNLDVRLEFDLCTEEKKFLQKRRKFVAS
ALKKALHLEQDLQDHEVPVVAVMTTGGGTRALTSLLGNLLGLQKLDLLDAISYITGSSGS
TWTLSHLYQSTDWSRKDLSRPIGEIRRHMTKCKLSCFSLESLKYYDKELKLRKQEGYQIS
SVDFWGLLLEKALSDGKNNHKLSDERQALNQGQNPLPIYMILNMKNDYSLSEFKEWVEFT
PYEVGFLKYGAFIRAEDFGSEFFMGRLMKRLPESRICFMKGLWSNVFSYNLLDACHLSDP
TQRRSLRCTQQRTVDVEGGEPSSPDRNHELETYLVTPECGIMGIIRQVLTERVMVSKFYN
FLKGFQVHNEYLQSKSFCIWKDTVLDHFPNQLTETAEFMCLADTAGYIDISYPPLMRPER
KVDIVLHLNYSSGSQTLPLEEASKYFLKQGIPFPKIHLSEEEKKNLKECYIFEDAETPEA
PIVVFFPLVNDTFRKYKEPGVERSPVEMAQGNVDVSSIFSPYCLNSFTYTGEEFDKLVEL
TSYNIQNNKHLILQALNSAIEQKRQHKN
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgggatcatactggagtgctcatgagagtgaagaatgtccgtgctgcttgctctctgta
aaaattgtaagaatgagaaatttgagaaaggcagatatgtttactcaaactgattgctat
gtaagcctgtccttgcccactgcttcccctaagactgtccggacaaaaaccatcaagaac
tgcagagatccagtgtggaatgaaacattttgcttcaggatccagagtcaagtaaaaaat
attcttgagctaaaggtctatgatgaaaatgcaatcactgaagatgacctcctcttcact
gtcctctttgatgttgctaaaatccagcttggagaaactgttcacttgacttttcaacta
aatccaaagacacaagagatgctggaggttgagtttgcatcggagagcattccagtctct
cctgaaaagcttgtcactaatggtgtattagtgtctcgtgaaatttcctgcttggaagtc
ctggtagacaataaacagacaaagaacgaaccttcagaaaaagacttcttattttcagtg
aagggatcctatgaagagagccagaccctgtcactgggctctccccagcgacctgcagag
cccctgcacttccattacatcaagtacagcctgtcagagctgtgcatggccctggcagag
aagaagcctcatttctgctcgtgtacctcaggagaagagaaaaaagactgccatgcatcc
ctcactattcctctggattcacttcccttcaaggagaaagttgcagtagcaaaggatgaa
acaatcaatttacatgtgaagtcaaataactggtcaaggaatttagatgttcgcttggag
tttgatctgtgtacggaagagaaaaaattcctacaaaaacggagaaagtttgtggcttct
gctctgaaaaaagcacttcatttagagcaagacctacaagaccatgaggtaccggttgta
gcagtgatgacaacaggaggtggcacccgggcactgacatctctgttaggcaacctgttg
ggtcttcagaagctggacctcttagatgctatttcatacatcactggatcatctggttca
acatggaccttgtcacatttgtaccagagcactgactggtcacgcaaggatctgtccaga
ccgattggtgaaatccgcagacatatgaccaagtgcaagctaagctgcttttcccttgag
agcttgaagtactatgacaaggagctaaaactgcggaagcaagagggataccagatctct
agtgttgatttttggggacttctgctggaaaaagcattaagtgatgggaaaaacaaccac
aaactctcggatgagcgacaggcattgaatcagggtcagaatcccctacctatctacatg
atcctcaacatgaaaaatgactacagtctttcagagttcaaagaatgggtggagttcacc
ccttatgaggttgggttcttaaaatatggcgccttcattcgtgcagaggattttggcagt
gagttcttcatgggtcgcctgatgaagaggctccctgaatcccgcatctgtttcatgaaa
ggcctgtggagcaacgtcttttcctacaacctcttggatgcctgtcatctgtcggatcct
acacaaaggcgctcactgaggtgtacccagcagaggactgttgatgttgaaggaggcgag
ccttcctcaccagacaggaaccatgagttggagacttatttagtcacccctgaatgtggc
atcatgggcatcattcggcaggtcctaactgagcgggtgatggtttcaaagttctacaac
tttctgaaggggttccaggtgcacaatgaataccttcagagcaaaagcttctgtatatgg
aaagatacggtactagaccatttccccaaccagctgacagaaacagcagagttcatgtgc
ctggcagacacggcgggatatattgatatcagctacccaccactcatgaggccggagagg
aaagtggacatcgtcctgcacttaaactattcttctggatcacaaacattgcctttggaa
gaagcctccaagtacttcctaaagcagggaatcccatttcccaaaatccacctgagtgaa
gaagaaaagaaaaatctaaaggagtgctacatctttgaagatgcagagaccccagaagca
ccaatagtggtgtttttcccactggtgaatgacaccttcagaaaatacaaagagcctggt
gtggagcgcagccctgttgagatggcacagggcaatgtggacgtttccagcattttctct
ccatactgcttgaacagctttacctacacaggggaggagtttgacaagctggtagaactg
accagctacaacattcagaacaacaaacatctgattcttcaggctttgaattcagctata
gagcagaaacgacagcacaaaaattaa

DBGET integrated database retrieval system