KEGG   Egretta garzetta (little egret): 104128526Help
Entry
104128526         CDS       T05152                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:egz00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104128526 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:egz03000]
    104128526 (CREM)
Transcription factors [BR:egz03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104128526 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf Rh5 TMCO5
Motif
Other DBs
NCBI-GeneID: 104128526
NCBI-ProteinID: XP_009639623
Position
Unknown
AA seq 358 aa AA seqDB search
MTKCARKYGKATVRQMTMEMVESQQDDNAVDSVPERDASHLQNQPGRSQISPVSKVSVAA
SSAGRGSPAVTLVQLPSGQTVHVQGVIQATQPSVIQSPHMQAVQVASIADESAESEGIID
SQKRREILSRRPSYRKILNELTSDVPAVPKIEEEEKSEDEGAPSGISAMAMPTSLYHTNT
GQYITITQGGAIQISNPSSDGVHGLQTLTMTNSGAPQPGATIVQYAGQSPDGTQQFFVPG
SQVVVQGAESELLHSHLLSATGDMPAYQIRTPTTTLPQGVVMAASPGTLHSPQQLAEEAT
RKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtgtgccaggaaatatggaaaagcaactgtcaggcagatgaccatggaaatg
gttgaatcacaacaggatgacaatgcagtggattctgtgccagagagagatgctagtcac
cttcagaatcagccaggccgaagtcagatttccccagtatctaaggtttctgtagctgca
tcaagtgctggaagaggatctccagctgtaactctagtgcagttgccttctggtcaaact
gttcatgtccagggtgtcattcaagccacacagccctcagtcattcagtcaccacacatg
caagctgttcaggtagcatcgattgcagatgaatctgcagaatcagaagggataattgat
tctcaaaaacgtagggaaatactttcaaggcggccttcataccgaaaaattttgaatgaa
ctaacatcagatgttcctgcagtaccaaagattgaagaagaagaaaagtcagaagatgaa
ggagcgccttctggaatttctgcaatggccatgccaaccagcctgtatcatactaacaca
gggcaatacattactataactcaaggtggtgcaatccagatttctaatccgtcctctgat
ggtgtccatggactacagacattaacaatgacaaattcaggagctcctcagccaggtgct
accattgtgcaatatgcaggacaatcacctgatggcacacaacagttttttgttccggga
agccaagttgttgttcaaggagctgaatctgaacttttgcactctcatttactgtctgcc
actggagacatgccagcttaccagattcgaactcccactactaccttacctcagggagtg
gtaatggcagcctcaccagggacgttgcatagccctcagcaactggcagaagaggcaaca
cgcaagagagagctgagacttatgaaaaatagggaagctgccagagaatgtcgcagaaag
aagaaggaatatgtcaaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaaaacaag
actctcattgaggaactcaaggccctcaaagatctttattgtcataaagcagaataa

DBGET integrated database retrieval system