KEGG   Egretta garzetta (little egret): 104128911Help
Entry
104128911         CDS       T05152                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:egz01002]
    104128911
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     104128911
Peptidases [BR:egz01002]
 Metallo Peptidases
  Family M10
   104128911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 DUF4953 Reprolysin_4 Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 104128911
NCBI-ProteinID: XP_009640061
Position
Unknown
AA seq 479 aa AA seqDB search
MRPENLLFLLLLCAALSCAVPADTRQKEDEGMQLMQKYLENYYGFKKDGESFIWKSNSPM
TQKIKEMQEFFGLEMTGKLDSGTLDLVQKRRCGFPDVASFSTFAGEPKWAKQVLTYRILN
YTPDLRPADVNAAIKKALSVWSSVTPLKFIKKDRGDADIMISFAARGHNDFIPFDGPGGS
VAHAYAPGKDFGGDAHFDEDETWTKSTEGTNLFYVAAHEFGHSLGLFHSKDPNALMYPIY
RKFDPSVFPLHQDDINGIQFLYGPSSNTHNDQRESTEIKDPTESKDPTLPNTCGPNMIFD
AVTTFRGEMMFFKGKHFWRKHPAVRTADFNLISSFWPWLPPGVDAAYEIPEKDKTVIFKG
NEFWVVRGDAILPGYPQKIYTLGFSKDVTKIDAAFYNGNEGKIYYFRGDKFWSYDKRSQS
MDRFPMLIRDAFPGINGKIDAVFQHENFLYFFHGRKQFEFDPVKKRVTRLLKTNFWFPC
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagaccggagaacctcctctttctcctattactatgtgcagcactttcttgtgcggtt
cctgcagatacaaggcagaaggaagacgaaggcatgcagcttatgcagaagtacctggaa
aattactatggctttaagaaagatggggaatctttcatttggaaaagtaatagtccaatg
acccaaaaaataaaagaaatgcaggaattctttgggctggagatgacggggaaactggat
tctggtactttggacttggtacagaaacgtcgctgtggattccctgacgtagcgagtttc
tccacctttgcaggagagccaaaatgggcaaaacaagttctgacatacaggatattaaat
tacacaccagacctgcggccagcagatgtcaatgcagctatcaagaaagcgttaagtgtt
tggagcagcgtgaccccactgaaattcatcaagaaggacagaggtgatgcagacataatg
atctcctttgcagccagaggtcacaatgacttcatcccctttgatggcccaggagggtcc
gttgctcatgcctacgcacctggcaaggactttggtggagacgctcacttcgatgaggac
gaaacctggaccaaaagcacagagggtacaaacctgttttatgttgctgcccatgagttt
ggccattcactaggacttttccattccaaagatcctaacgctctgatgtacccaatttat
aggaaatttgacccttcagtattccctcttcatcaggatgatattaatggcattcaattc
ctctatggaccatcttctaacacccacaatgaccaaagggaatctactgagataaaagac
ccaaccgagtcaaaagatcccacactgccaaacacctgtggccccaatatgatttttgat
gctgtcaccactttccgtggagaaatgatgttctttaagggcaagcatttttggcgcaag
catcctgcagtcagaacagctgattttaatttaatatcttcgttctggccatggctgcca
cctggtgttgatgctgcatatgaaatccctgaaaaagacaaaactgtcatttttaaaggg
aatgaattctgggttgtgagaggagatgccatacttcctggatacccccaaaaaatctac
accctgggattttcaaaggatgttaccaaaattgatgctgctttttataacggaaatgag
gggaaaatatattacttcagaggggacaaattttggagctatgataaaagaagtcagtct
atggacaggtttcccatgttgataagagatgcatttccaggaattaacgggaagattgat
gctgtttttcaacatgaaaacttcctttatttcttccatggaagaaaacaatttgagttt
gaccctgttaagaagagagttacacgcctcttaaagacaaacttttggtttccatgttaa

DBGET integrated database retrieval system