KEGG   Egretta garzetta (little egret): 104129330
Entry
104129330         CDS       T05152                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:egz01002]
    104129330 (ADAMTS13)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     104129330 (ADAMTS13)
Peptidases and inhibitors [BR:egz01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   104129330 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 TSP1_CCN Reprolysin_3 Reprolysin_5 Pep_M12B_propep Reprolysin_2 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 104129330
NCBI-ProteinID: XP_009640547
Position
Unknown
AA seq 1465 aa
MIVSLTIRALVMLPLGFCWPSAFQEKFLGALDAEDVFSYFGASSVSDVPEFVVAEPTCPC
KEEQMGLTSCRIQHCSIEAWGELYAFEFLEDHALLSSSFVSNQVVNSSFSLLKRFSGNCF
AGGNPLQPPGAKCRVTYCEGQLQGVVTADEEKIHIRPVRSKDMALLKDLGFSRPHILFRS
AARGENTARGRFPSRLQKRAEGAVKHLELMVVAGPDVYLYHREDTERYILANLNIGAELL
RDASLGAHFRVHLMQILVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIV
LYVTRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIPHD
GEGNQCSSSGFIKXKTGSHNSIDLTWSQCSREEFLAFVSTGQTSCLNDLPDMDGSIPGWK
PGLYYGADEQCKIAFGSVATACTFADTNVDICEVLSCHVQPGDKSSCTRLLVPLLDGTEC
GINKWCSKGQCSSLEELNPMAVVHGQWSIWSPFSSCSRSCGGGVVIRQRFCNNPRPAFGG
XECPGASIQVEMCNTQACLMTQQDFMAEQCAATNLKPLYVTVEAPSFYAWTSAVGFAKGD
MLCKHMCRAIENEFMVSREDSFIDGTRCEQDDSERHGAFNLCVMGSCRAFGCDGLMDSKK
IMDSCKVCGGDNTTCTKVSGSYTEGKAKEYVTFLSLPYNATLVHVTNRRPLFTHLAVKVK
GEYVVAGKGKISLNVTYPSVLEDSQIKYKVFLTKDNLPSLEEVHVDGPTQEEIEIQVYRR
YAREYGNATNPDITFSYFVPKENLTYMWILQQGPCSVTCGEGMQPVDHVCFDQTKNEIIE
DQWCLELPRPLSEHKPCALEPCLYRWKISQIDQCSAVCGTGVAQQNLTCIQFRDGLETVV
DDSLCLAEEKPLSVVPCVVNVCPLGWDKEEDAHLRQISESFGHIQLENRTVYVWSPLAGE
CSVSCGRGKTQLQYVCVAFDTKEETQEENCHPVPKPESRMEVCDLSPCPPRCHYKMGSYS
VSCGGRDVMHKVLYCARETWEKAGEIVADTQCDGLPCPEEQEPCNLELCPLRWKVIPAGP
CSSSCGLGLAVQLVTCVQIRQGKEILLEDRLCPVAEKPLTSIPCVIRMCSYEWSFSEWTE
CSTSCGNGIQTRQDFCLNPLTRKHVNPIFCRHFPKAIVVRGCFLGPCPEQAVGTGSHGAE
LQTVTPATHLTTAAAAKGVRYKDLDLPPSAVPAVPQEQTKTSGGVCGKLFLNATGVINMT
GVESSDCTVAIGRPLREEITISILESSLNCSAGEAVLFSGRMMWQTGCRKLPLSLINSRT
NTLIVKQRVLLPGNGVILQYNSRTATKKYYQDCDKQLFGPRGEIVNPVQLPDQRQEVVCR
TFINVAPRHRIAIRALYVDQGNESNQTHFNYVLVRDVSTMKTMVFHGKQQFFWQSTGSQA
EIEFHENVKGHRTSFWAEYHAIEPK
NT seq 4398 nt   +upstreamnt  +downstreamnt
atgattgtcagcttgacgatccgggcgctcgtgatgctccccttggggttctgctggccg
tcggctttccaagagaaatttctcggtgctttggatgcagaagatgttttctcttatttt
ggagccagctcagtgtctgacgtacctgagtttgttgttgctgagccaacttgcccttgt
aaagaagaacagatggggctgacatcctgtcgtattcaacattgctccatcgaggcctgg
ggagaactctatgcctttgagtttctagaggaccatgccctcctttcctcttcctttgtg
agcaatcaagtggtgaactcttcctttagcttactgaagcgattctcaggcaactgcttt
gcaggtggaaatccactgcaacctcccggggctaagtgtagagtcacttactgtgaaggg
cagctgcaaggagttgtcactgcagatgaggaaaagattcatatcaggcctgtcagaagc
aaagatatggccctgctgaaggacctcggcttctccagaccccacatcctcttcagaagt
gccgcaagaggagaaaatacagcaagagggcggtttccttctcgcctgcagaagagggct
gagggagctgtcaaacatctggagctgatggttgtagcaggtccagatgtttacttgtac
cacagagaggacacggagcgatatatccttgccaacctgaacatcggggcagagctgctg
agagatgcctcgctgggtgctcatttcagggttcatcttatgcaaatacttgttttgaga
gaaccagaggcagaggtaaacatcacaacaaatatcacctcctcgctgatcagcgtttgt
gagtggagcaagaaggtcaaccctcagaatgactctgacccccagcatgctgacattgtc
ctctacgtcaccaggtttgacctggagttacctgatgggaacaaagagctacgtggagta
actcagttaggtggagtctgctcctccttctggagctgtgttattacccaggacactggt
tttgaccttggagtcaccatagcccatgagattgggcacagtcttggaatcccccatgat
ggtgaggggaatcagtgcagcagcagtggtttcataaaannaaaaacaggaagccacaac
agcattgacctcacttggtctcagtgcagccgagaagagttcctggcctttgtcagcaca
ggccaaacaagctgcttaaatgacctgccggacatggacggcagcatccctgggtggaag
cctggcttgtactatggagcagatgagcaatgtaaaatagcctttgggagtgtggccaca
gcatgcacctttgctgacaccaatgttgacatctgtgaagttctctcatgccatgtacaa
ccaggagacaaatccagctgtactcgccttcttgttcccctcttggatggtactgagtgt
ggaatcaataagtggtgctccaagggacagtgcagctctctggaagaactgaaccccatg
gctgtagtccatgggcagtggtccatctggagccccttctcctcctgctcccgcagctgc
ggaggtggagttgtgatacggcagcggttctgtaacaaccccaggcctgcttttgggggg
taggaatgccctggcgccagcatccaagtggagatgtgcaatactcaggcctgtttgatg
acccagcaggactttatggctgaacaatgtgcagcaacaaatttaaagccactgtatgtc
actgtagaagcgccatccttttatgcctggacttctgctgttggctttgccaaaggggac
atgctatgcaagcacatgtgcagggccattgaaaatgaattcatggtaagccgcgaagac
agcttcatagatggaaccagatgtgagcaggatgactctgagcgccacggggctttcaat
ctgtgtgtaatgggaagctgcagagccttcgggtgcgatggcctgatggactccaagaag
ataatggactcctgcaaggtctgtgggggtgataataccacttgcaccaaagtgagtgga
tcttacacagaaggaaaagctaaagagtacgttacatttctgtccctgccatataatgcc
accttggtccatgttaccaatcggagaccacttttcacacatttggctgtgaaggttaaa
ggagaatacgtggttgctggaaaaggaaaaatctcactgaatgtcacctatccgtcagtt
ctggaggacagccagatcaaatacaaagtgtttctcacaaaggacaacttgccaagcttg
gaggaagtccatgtggatgggccaacacaagaagaaattgaaatacaggtctatcgaagg
tatgcaagagaatatggcaatgccaccaacccagacatcaccttcagctactttgtcccc
aaagagaatctgacatatatgtggattcttcagcaggggccatgttcagtgacctgtggg
gaagggatgcaaccagtggatcatgtgtgctttgaccagacaaagaatgagataatagag
gatcagtggtgtctggagctcccacggcccctttcagagcacaagccctgtgccctggag
ccatgcctgtacaggtggaagatatctcagatagatcaatgctctgctgtctgtggaact
ggagttgcccagcagaatctgacctgtattcagtttcgtgatggattggagactgttgtg
gacgacagcttgtgcctagcagaagaaaaacccctctctgttgtgccgtgtgtggttaat
gtctgccctttaggctgggacaaagaggaagatgcacacttacgtcagatttcggagtct
tttgggcatatccaactggaaaatcggaccgtgtatgtctggagccctctagctggagag
tgttctgtctcctgtggtagaggtaagactcagctacagtacgtatgtgtggcttttgac
accaaagaagaaacccaagaagaaaactgtcatccagttccaaagccagagagcaggatg
gaagtctgtgatctcagtccctgcccaccaaggtgtcattacaaaatgggctcatacagt
gtaagctgtggaggaagagatgtgatgcacaaggtcctctactgtgcgagggagacctgg
gagaaggcaggagagattgtggcagacacccagtgtgatggtttgccttgcccagaggag
caggagccatgtaatttggagctgtgccctctgagatggaaggtaatcccggctggcccc
tgttcctccagctgtggacttggcttagctgttcagctggtcacctgtgtgcagattcgc
caaggcaaggaaattttgctggaggaccgtttgtgtcctgtggcagagaagccccttacc
agcatcccctgtgtcatccgaatgtgctcttacgaatggagcttcagcgagtggacagag
tgttcaacttcatgtgggaatggcattcagacacggcaggatttctgcctcaacccgcta
acccgtaagcacgtgaaccccatcttctgcaggcacttccccaaggccattgtggtacgt
ggttgcttcttggggccctgtcctgagcaggcagtggggaccgggtcccatggagcagaa
ctgcagacggtgacaccagccacacatctgacgacagctgcagctgctaaaggggtgaga
tacaaggacctggatcttcccccatctgctgtgccagctgtgcctcaggaacagacaaag
accagtggaggtgtctgtggaaagctctttcttaatgctactggcgtcatcaacatgacg
ggtgtagaaagcagcgactgtactgtggccatcggacgccctctcagggaggagataaca
atcagcatcctggagagctccctcaactgcagtgcaggtgaggcagtgctgttttctggg
cgaatgatgtggcagacaggctgcaggaagctccctttgtcactgataaattccagaacg
aatacactgattgtgaaacaacgcgttttgctgccaggaaatggggtcattcttcagtac
aacagcagaactgcaactaaaaaatattaccaagactgtgacaagcagctgtttggtccc
cgaggtgaaatagtgaatcctgtgcaattgcctgaccaaaggcaagaagtagtatgtcgg
accttcatcaacgtggctcctcggcatcgcatagctatccgcgccctatatgttgaccag
ggcaatgagagcaaccaaacacattttaattacgtcttggtccgtgatgtaagcaccatg
aagacgatggtgttccatggaaaacaacaattcttctggcaatcaacaggaagccaagct
gaaattgaatttcatgaaaatgttaaaggtcaccgaaccagtttctgggctgaatatcat
gctattgagcccaaataa

DBGET integrated database retrieval system