KEGG   Egretta garzetta (little egret): 104129408Help
Entry
104129408         CDS       T05152                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04260  Cardiac muscle contraction
egz04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104129408 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104129408 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    104129408 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:egz04040]
    104129408 (CACNG5)
Ion channels [BR:egz04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104129408 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DHHC
Motif
Other DBs
NCBI-GeneID: 104129408
NCBI-ProteinID: XP_009640631
Position
Unknown
AA seq 279 aa AA seqDB search
MLLGMSTCGRKALTLLSSVFAVCGLGLLGISVSTDYWLYLEEGIVQPQNQTAEIKLSLHS
GLWRVCFLAGEERGRCFTIEYIMPMNIQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFI
LSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSETFFNYKYG
WSFAFSAISFLLTESAGVMSVYLFMKRYTAEDIYRPHPGFYRPRLSNCSDYSGQFLHPDA
WARGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgggaatgagcacctgtggcaggaaggcgctgaccctgctcagcagtgtgttt
gccgtctgcggcctcggcctcctgggcatctccgtcagcaccgactactggctctacctg
gaggagggcatcgtccagccccaaaaccagacagcagaaatcaagctgtcgctgcactcg
gggctctggagggtctgctttctggcaggcgaggagcgtggccggtgcttcaccatcgaa
tacatcatgcccatgaacatccagctgacgtctgagtccacagtcaacgtcctcaagatg
atccgctctgccacccccttccctctggtcagcctcttcttcatgttcattggcttcatc
ctgagcaacatcggccacattcggcctcacaggaccatccttgccttcgtctcggggatc
ttcttcatcctctcgggtctgtccctggtggtggggctggtcctctacatatccagcatt
aatgacgagatgctgaacaggaccaaggactcggaaacattcttcaattacaaatatgga
tggtcctttgccttctctgccatctccttccttctcacggagagcgccggggtgatgtcc
gtttacctgttcatgaagcgatacacagccgaggacatctaccgacctcaccccgggttc
taccgtccccgtctgagcaactgctctgactactcagggcagttcttgcacccggacgcg
tgggcgcggggacgcagcccttcggatatctccagcgaggcgtccctgcagatgaacagt
aactacccggctctgctcaagtgccccgactacgaccagatgtcctcgtccccgtgctga

DBGET integrated database retrieval system