KEGG   Egretta garzetta (little egret): 104129561Help
Entry
104129561         CDS       T05152                                 

Gene name
ZDHHC5
Definition
(RefSeq) LOW QUALITY PROTEIN: palmitoyltransferase ZDHHC5
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egz04131]
    104129561 (ZDHHC5)
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104129561 (ZDHHC5)
Membrane trafficking [BR:egz04131]
 Protein recycling
  Others
   GRIP associated proteins
    104129561 (ZDHHC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 104129561
NCBI-ProteinID: XP_009640805
Position
Unknown
AA seq 745 aa AA seqDB search
MPAASGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYISPVIPVYNAVVFLFVLA
NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC
SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTTHIMGVFGFGLLYVLYQVEELSG
VRMAVTMVVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCKNV
SRVLCSSPAPRYLGRPKAEQTVLVRPPFLRPEVSDGQITVKIMDNGIQTELKRTKSKGSL
EVTESQSADAEPPPPPKPDLSRYTGLRTHLTLATNEDSSLLRKASPRXGHAQQGGCPASR
GCCHVPGWGKSWGQGGPLGALQGPHLSVGDCCVSAPQLSRVNSLKEPNSICDSSRKPSYR
SEPSLQPESFRSPTFGKSFHFDPLSSGSRSSRLKSAQGTGFEMGHLQSIRSEGTTSTSYK
SLVTQTRNGSLSYDSLLTPSDSPDFESVQAGPEPDPPGGYTSPFLSARIAQQRETDLHGR
FASAVSPKHAPPREPSPVRYDNLSRHIVASIQEREKLLQQPTAPGREEDAGLVDSGIQST
PGSSNAPRTSSSSDDSKRSPLGKNPLTRPAPPRFGKPEPPNALRVRSLGSPDQPAAPHLG
KSVSYSSQKPASQASVPETEEVALQPLLAPKDEVQMRTAYSKSNGQPKSLGSAPPGPGQV
PLSSPTRGGVKKVSGVGGTTYEISV
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagcatctggaaagagattcaaacccagcaaatacgtcccggtctcagctgct
gccatctttctagtgggagccaccaccctcttctttgccttcacatgcccagggctcagc
ctgtacatctccccggtcattcctgtctacaatgctgtcgtcttcctcttcgtgctggcc
aacttcagcatggccaccttcatggacccaggcatattcccgcgagctgaggaggacgag
gacaaggaggacgacttccgagctccgctctacaagactgtggagatcaagggcattcag
gtgcgcatgaagtggtgtgcgacctgccgcttctaccggccgccacgctgctcccactgc
agtgtctgtgacaactgtgtagaggagttcgaccatcactgcccttgggtcaacaactgc
atagggcggcgcaattaccgttacttcttcctcttcttgctgtcgctcaccacacacatc
atgggggtgtttggctttggcctgctctacgtcctctaccaggtggaagagctctccggc
gtccgcatggcggtcacgatggtggtgatgtgcgtggccggcttattcttcattcccgtc
gcgggccttacgggtttccatgtggtgcttgtggcaaggggccgtactaccaacgaacag
gtgacgggcaagttccgtggtggtgtcaaccccttcaccaacggttgctgtaagaacgtc
agccgggtcctctgcagctccccggcccccaggtacctcgggcgcccgaaggccgagcag
acggtgctggtgagaccccccttcttgcggcctgaggtgtcagatggtcagatcactgtc
aagatcatggacaacggtatccagacagagctgaagaggacgaagtccaaaggaagcctg
gaggtgacggagagccagtctgctgacgctgagccaccccccccacctaagccagacctc
agccgctacacgggcctgaggacacacttaaccctggccaccaacgaggacagcagcctg
ctacgcaaggccagcccaaggtaaggccatgcccagcaaggggggtgcccagcctccagg
ggatgctgccacgttcctggttgggggaagagttgggggcagggggggccgttgggagct
ctgcaggggccccatctttctgtgggtgactgctgtgtctctgcccctcagctgagccga
gtgaacagcctgaaggagcccaactccatctgtgacagcagccgcaagcccagctaccgc
tccgagccaagcctgcagcccgagagcttccgctcccccacctttggcaagagctttcac
ttcgacccgctctccagtggctcccgctcctcccgcctcaagtcagcccagggcacaggc
tttgagatgggccacctccagtccatccgctcggagggcaccacctccacctcctacaag
agcctggtgacccagacgcgcaatggcagcctgtcgtacgacagcctgctcacgccctcc
gacagccccgacttcgagtcagtgcaggcgggcccagagcctgacccaccggggggctac
acctcgcccttcctctcagcccgcatcgcccagcagagagagaccgacctgcacggccgc
ttcgccagcgccgtctcccccaagcacgcgccaccccgcgagccctcgcctgtgcgctat
gacaatctctcccgccacattgtggcctccattcaggagcgggagaagctgctgcagcag
ccgacggccccgggcagggaggaggacgcggggctggtggactcgggcatccagtcgaca
ccaggctccagcaacgccccccgcaccagctcttcctcggacgattcgaagcgctcgccc
ctgggcaagaacccgctcacccgcccagccccaccccgctttggcaagcccgagcccccc
aatgcgctccgggtgcgctccctgggctcccctgaccagcccgctgccccccacctgggc
aaatccgtgtcttacagcagccaaaaaccagcgtctcaggccagcgtccccgagacggag
gaggtggccttgcagcccttactagcaccaaaggacgaggtgcagatgagaacagcctac
agcaagtccaatgggcagcccaagagcctgggctcagcgcctccgggcccggggcaggtg
cccctcagcagccccacccgtggaggagtcaagaaggtctctggcgtgggggggaccacc
tacgagatctcagtatga

DBGET integrated database retrieval system