KEGG   Egretta garzetta (little egret): 104129843Help
Entry
104129843         CDS       T05152                                 

Gene name
PISD
Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00564  Glycerophospholipid metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104129843 (PISD)
Enzymes [BR:egz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     104129843 (PISD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 104129843
NCBI-ProteinID: XP_009641111
Position
Unknown
AA seq 374 aa AA seqDB search
MCQSNTLQGPDLHTGKWLQFPQLALRRRLGQLSCMSRPALKLRSWPLTILYYLLPFGALK
PLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAA
VEDLHHYRNLSEFFRRKLKPQARPVCCLHSVISPSDGKILNFGQVKNCEVEQVKGVTYSL
ESFLGPRICTAELHFSQAPPGNSFQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVS
HRRHFPGSLMSVNPGVARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQ
DLHTNSPCYSKGSYNDFSFVSNNNKEGIPMRKGEHLGEFNLGSTIVLIFEAPKDFKFHLK
AGQKIRFGEALGSL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcagtcaaacaccctgcagggaccagatctgcacacagggaaatggttgcaattt
ccccagctggccctgaggcgaaggttgggccagctaagctgtatgtctaggcctgctctg
aaactccgttcttggcctctgactattctctattatcttctgcctttcggtgctcttaaa
cccttgaccagagtgggatggaggcctatgagcagggttgctctgtacaaatcggtacca
actcgactgctgtcacgagcctggggtcgcctgaaccaggtggagctgcctacatggctg
cggaagccagtttacagcctgtacatctggacatttggagtgaacatgaaggaggcagct
gttgaagatctgcaccactatagaaacctcagcgaattcttccgcaggaagctgaaacca
caagcgcggccagtctgctgtttgcacagtgtgattagtccctctgacggaaagatcctt
aattttggacaggtaaaaaactgtgaagtagagcaagtaaaaggagttacttattctctg
gaatctttcttgggacctcgcatctgcacagcagaactgcattttagccaggccccacct
ggtaactcttttcagcaacaactggtcacaaaggaggggaatgagctctatcattgtgta
atctaccttgcaccgggggattatcactgcttccactcacccactgactggagagtgtca
caccgacgtcacttcccaggctctttgatgtctgtgaatcctggagttgctcgctggatc
aaggaactgttctgccacaacgaacgggttgtccttacaggtgactggaagcatggcttt
ttctctttaacagctgtaggagcaacaaatgtcggctctatccgcatctactttgaccag
gacttgcataccaacagtccgtgttactctaaaggttcctacaatgacttcagcttcgta
tccaacaacaacaaggagggaatccccatgaggaaaggggaacatttaggggaatttaac
ttaggctctacaatcgtactgatctttgaggcacccaaggacttcaaatttcacctcaaa
gctggacagaaaatccgctttggagaagcactggggtctctatag

DBGET integrated database retrieval system