KEGG   Egretta garzetta (little egret): 104130062Help
Entry
104130062         CDS       T05152                                 

Gene name
GUCY1A2
Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00230  Purine metabolism
egz01100  Metabolic pathways
egz04270  Vascular smooth muscle contraction
egz04540  Gap junction
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104130062 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104130062 (GUCY1A2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104130062 (GUCY1A2)
Enzymes [BR:egz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104130062 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 104130062
NCBI-ProteinID: XP_009641348
Position
Unknown
AA seq 842 aa AA seqDB search
MSRQRQVTSVVPQSSVLGLVLFNTFTDHIDSGIECILSKSADDTKLSAAANMPEGQDAIQ
RDLGKLKKSGGSFALLEGRVRSSETGRFLYKCILQTASSGGVSAIVMAGVPRSGSLLAAV
QRRRALVAAAVGFGCSTEVPGGRVIGESEQVVRITEDGWVFPEALQNQEPEPHVARKEGK
IEITLEGQGWKLLIWRRPKPNATISFIILPXPQTIRQTLQRTLQYFEHQVIGYRDAEKNF
HNISNRCSYTDCSGNEEAEDVSGILQCTANVLGLKFEEMQEKFGEEFFNVCFDENERVLR
AVGGTLQDFFNGFDALLEHIRTSFGRQATLESPSFLCKELPGGNLMLHYFHPHQIVGLAM
MGMIKAAAKKIYRLEVEVEQVTNDKLCSEGTNPGNCSCLTFLIKEHENANITKALPPGTS
QSPLDLRISISTFCRAFPFHLMFDPNMVVLQLGEGLRKQLRCDAHKTLKFEDCFDIVSPK
ISATFERVLLRLSTPFIIRTKLEDSGSENRDKVMEIKGQMIHVPESNSILFLGSPCVDKL
DELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLECTHQALEEEKKKT
VDLLISIFPEEVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELY
TRFDHQCGFLDIYKVETIGDAYCVAAGLHKKSLSHAKAIALMALKMMELSEEVLTPDGSP
IKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKKEE
NFIFIPRSREELPENFPKEIPGICYFLEVRSGQKPPKPSITSARVRKVSYNIGTMFLRET
SL
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacagagacaggtgacaagtgttgtccctcagagctctgtattgggactggta
ctgtttaataccttcactgatcacatagacagcgggattgagtgcatcctcagcaagtct
gcagatgacaccaagctgagtgctgcagctaacatgcctgagggccaggatgctatccag
agggacctgggcaagctcaagaagtctggaggcagttttgcactactggagggccgggtg
agatccagcgagacgggcagatttctgtacaagtgcatcctgcaaacggcgtcgtctggt
ggagtctcagccattgtcatggcaggagtgccacgctcaggatcgctgctggcggctgtg
cagcggcggcgggctttggttgcagcggcggtgggctttggttgcagcactgaggtgcca
ggtggaagagttataggagagagtgagcaggttgtacgcatcacggaggatggatgggtc
tttccagaggccctgcagaaccaagaaccggagccccatgttgcaaggaaggagggaaaa
atagagataacccttgagggtcaagggtggaaactcctgatatggaggaggccgaagcct
aatgctacaatttcttttattattcttccatagcctcagaccattcggcaaactcttcaa
aggacgctgcagtattttgagcatcaagttattggttacagggatgcggagaagaacttt
cacaatatatcaaacagatgctcctatacagactgctctggcaatgaagaagctgaagat
gtctcaggaattctccagtgtacggctaatgttcttggtttgaagtttgaggaaatgcaa
gaaaagttcggggaggaattcttcaatgtctgctttgatgagaatgaaagagttcttcga
gctgtaggcgggacccttcaagacttcttcaatggctttgatgctttgctggagcacatt
agaacttcatttggaagacaggccaccctggaatccccttctttcctatgcaaagagctc
cctggaggcaatctcatgcttcattactttcacccacatcagattgtgggattagcaatg
atgggaatgataaaggcagcagcaaagaagatttaccgcttggaagtggaagtagaacag
gtcactaatgataagctgtgttcagaggggacaaacccaggtaactgcagctgtctgact
ttccttatcaaggaacatgaaaatgcaaatatcacaaaagcacttccaccgggaacttcc
cagtcccccttagacctgaggattagcatcagcaccttctgcagagctttcccctttcac
ctgatgtttgatccaaacatggtggttctgcagcttggagaaggtcttaggaagcagctc
agatgtgacgctcataaaactctgaaattcgaagactgcttcgacatagtttctcctaaa
atcagtgccacatttgaacgagttctcctgagattatctactccctttatcattcggacc
aaacttgaggattctggctctgaaaatagagataaggtgatggagattaaaggacaaatg
attcatgtgccagaatcaaattcaattttgtttctgggttccccctgtgtggacaagctg
gatgaactgatgggccgaggcctccatctttcggacatacctatccatgatgctactcgt
gatgtcatactggttggggagcaagcaaaagcccaggatggcttgaaaaaacgaatggat
aaactgaaggcaacgctagaatgcacacatcaagccctggaagaggagaaaaagaaaaca
gtagatctccttatttctattttccctgaagaagtggctcagcagttgtggcaggggcag
caagttcaggccaggaagtttgatgatgtcaccatgctcttctcagacattgttggcttc
actgccatctgtgcgcagtgcacgcccatgcaggtcatcagcatgctgaacgaactctac
acacggtttgaccatcagtgtggattcctggacatctacaaggtggaaacaataggtgat
gcgtactgcgttgcagcagggctccataagaaaagtcttagtcatgctaaagccattgcc
ctgatggcactgaagatgatggagctttcagaagaggttctcactccagatgggagcccg
attaagatgaggataggcattcactcaggatcagtgctggccggcgtcgttggtgtaaga
atgccacgttattgtctctttgggaacaatgtcacccttgcaagcaagttcgagtcagga
agtcacccacgccgcatcaatgtcagtccgaccacataccagcttttgaaaaaggaagaa
aattttatttttatccctcgttcccgtgaagagcttccagaaaactttccaaaggaaatt
cctgggatctgttacttccttgaggtcagaagtggtcagaagccgccaaaaccctccatc
acatctgccagagtgagaaaggtttcttacaacattggcaccatgttcctccgggagact
agcctatga

DBGET integrated database retrieval system