KEGG   Egretta garzetta (little egret): 104130446
Entry
104130446         CDS       T05152                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:egz03000]
    104130446 (AHRR)
Transcription factors [BR:egz03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104130446 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 Herpes_U5
Other DBs
NCBI-GeneID: 104130446
NCBI-ProteinID: XP_009641786
Position
Unknown
AA seq 760 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNVSNKTAVQEGGLLLETLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMSS
GQQLQTETGEEYILSKLFKAQENGSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKNLLVKAKHKADDSAAVNTN
SNSKGNSGLCEAAELYGRNSHHEGATFTNVLQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKIPSSFASLKGNLEGLSYNSAIETLGQ
WKHLNWTAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRMNTCSNRRAGSFYNRDQSFLNLASTCPSHWGSADSCQSYSGVQQRCVESYATT
DHLKLQRPVISSESFYEAAFPLETPIKTEYDSDSENIADNYLPSQNRAWLDENGSVRKQV
FTYPNRVHLKTEPDLCDPASACQKPRHCLYTPHNWQCIVANHPNNLNLNRPCKGSRSKEV
APFCPQNSSGCLESMPDLPHMACYGHFYSPSPGEEKEENNEVFKMPCEFKNPCLVQAIKR
EPLDSPPLSNSGQNRVHVSFPENTLAGPVSHKITECTFLQ
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctatatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgcagttgggaatgaaaaatcaaatccttcaaagagacaccgggaccgtctg
aatgcggaactggaccacctggccagcctcctgccttttccacctgacatcatatcaaag
ctggacaaactttccgtcttgcgccttagcgtcagctatctccgggtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggccaaacgataaaagaagacaat
gtatctaacaagactgctgtacaagaaggtggacttctactagaaacactgaacggtttt
gcattggtggtgagtgcagatggaatgatattttatgcatcatcgacaattgtggactac
ttagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgtggat
gatcgccaggatttctgtagacaactgcactgggccatgaatcctccccagatgtcatct
ggacaacaactacaaacagaaacaggagaagaatatattcttagtaaattgtttaaagcc
caagagaatggcagcatgacaacagattattcttccttcctaactcgttgtttcatctgt
cgagttcgctgcttgttggacagtacttctggcttccttacgatgcaattccaaggcaaa
ctcaagtttctttttggacaaaggaagaaatcctcatcaggaacagtactgccacctcag
ctgtccttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaaacctgcttgtgaaagcaaaacacaaagctgatgattcagcagcagtgaatacaaac
tctaattccaaaggcaactcagggctgtgtgaagcagcagaattatatggaagaaacagt
catcatgaaggtgccactttcactaatgtgctacagattgctgaaaaccagatcaaagca
aagaataatggagaaaatggcatttctctagtcaaagtacaaacgaatgaagatcactgg
gtctgggttcaagctaacactcaactgctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacaactgaagataccaagcagttttgcc
agtttgaaaggaaacctggagggactttcctacaacagtgccattgaaactctgggccag
tggaagcatcttaactggacagcagtaaaaaatgaacaagataatgtaaaagtgaagttt
gagcctcatacaaacggtgagtgttttatgcaagaggaacctctcagttccaacacatca
gttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcaagc
tcttgttctatgagccagcgaatgaacacatgctccaacaggagagctggatcattctac
aacagagaccaaagtttcttaaatttagcatcaacttgcccttcccactgggggagtgca
gacagctgccagtcttactcgggtgtacaacagcgttgtgtggagagctatgcgacgacg
gaccatctgaaacttcagagaccggtaatatcctcagagtctttctatgaggcagccttt
cccttggagacgcctatcaaaacggaatatgattctgattccgaaaacattgctgataac
tacctgccgtcacaaaaccgagcctggctggatgagaacggctcggtgaggaagcaggtg
tttacctaccccaatagagtgcaccttaaaacagaaccggacctctgtgacccagcctca
gcttgtcagaagccaaggcactgcctctacacacctcataattggcaatgcatcgtagca
aatcatcccaacaacttaaacctgaaccgaccttgcaagggttcacgtagcaaggaggtg
gccccgttttgccctcagaactcctctgggtgtttggaaagcatgcctgacctgccgcac
atggcgtgctatggccacttctacagccccagcccaggggaggagaaagaggagaataat
gaggtgtttaaaatgccatgcgaatttaaaaacccctgcttggttcaagcaatcaagcgt
gagcctctggattctccaccactgtccaacagtggacagaacagagtacacgtgagcttc
cctgaaaatacattagcaggtcctgtgtctcataaaatcactgaatgtacatttttacaa
tag

DBGET integrated database retrieval system