KEGG   Egretta garzetta (little egret): 104131244Help
Entry
104131244         CDS       T05152                                 

Gene name
DCXR
Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00040  Pentose and glucuronate interconversions
egz01100  Metabolic pathways
Module
egz_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104131244 (DCXR)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     104131244 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 104131244
NCBI-ProteinID: XP_009642695
Position
Unknown
AA seq 167 aa AA seqDB search
MRYGHKNAAGNRIKVQLAQWLFHNRSLGVNLQAVLHVSQIVARQMIAQGVPGAIVNVSSQ
ASQRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVNPTVVMTDMGRINWSDPQKS
AAMIDRIPLGKFAEVDDVVNSILFLXXXXXAMTTGSSLMVDGGFLVS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgggcataagaatgctgcagggaatcggatcaaagtccagctagcacagtgg
ctgttccataacaggtctcttggtgtgaatcttcaggctgtgcttcatgtttcccagatt
gttgctcggcagatgattgcacagggggtgccaggtgctattgtaaatgtctccagccag
gcatctcagcgtgctctgcgggatcacgctgtttactgttccacaaagagtgctttggat
atgctgagcaaggtaatggcaatggaactgggaccccacaagattagggtgaacaccgtg
aaccccacagtggttatgaccgacatggggagaattaactggagtgaccctcagaaatct
gctgccatgattgatcggattccactgggaaagtttgcagaggtggatgatgtggtgaac
agcattctcttcctgnnnnnnnnnnnnnntgctatgacaacgggcagctcactgatggtt
gatgggggatttcttgtctcctaa

DBGET integrated database retrieval system