KEGG   Egretta garzetta (little egret): 104131672
Entry
104131672         CDS       T05152                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egz01009]
    104131672 (AKAP5)
Protein phosphatases and associated proteins [BR:egz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     104131672 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 104131672
NCBI-ProteinID: XP_009643163
Position
Unknown
AA seq 465 aa
MAKAAKEIQMENPGEVDTQGTGATCSPAEEQAEKPSMLCFKKRKKSCKKGLTTKDACEGA
SEEKSQCVSTDQGEAKVSDQPRSSKGAWAAIKNLARPRRRQKSSSRKKVPSNSQVQLEMD
AEEGCAHGFQKKRASSGVKVPCVQFSRGKKKPSPSEAVEESEGSVQANEVVGVLNKASEE
PEDLAPTDKSESFSPVSAEEDQDTGKESTDSVGKSEPLPEPTADAEEHTECAAQSEFTDS
ETINETPQEKPQEGSLPQSPVHTEGQEVAPEAPVSKDQPDSTPETTELQEIPNICKELPE
GDESEKSINLPEECKAEETVMDFSQPAFKDDAASVQGCSGHQVTLEANRGAGIGIVITVT
EAEDSDNTDSDQAYEPSPVLHRNKQKGNKKSSGSFDFGKKEGPEAGGGPQAEEKGPGDQG
HRTGEQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcgaaggcagctaaggaaatccaaatggagaacccaggagaggtagatactcagggc
acaggggcgacgtgctccccagcggaggaacaggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaggggctgaccacgaaggatgcgtgcgaaggagcc
tcggaggagaaaagccaatgtgtcagcacagaccaaggggaggcgaaagtttctgatcag
ccgcgatcctccaaaggagcctgggcagccatcaaaaacctcgcaagacctcggagaagg
cagaaatcctcctcgcggaagaaggtgccctccaattcccaagtgcagctggagatggac
gctgaggagggctgtgcacatggcttccaaaaaaaacgggcgagctccggggtgaaggtg
ccctgcgtgcagttctccagaggcaagaaaaaacccagcccctctgaagcagtggaggag
tcggagggtagtgttcaagcaaatgaagtggtgggcgttttgaataaagctagtgaagag
ccggaggatttggccccgacggacaagtctgaatccttcagcccggtctctgcagaggag
gaccaggatacagggaaggaaagcactgactctgttgggaagagcgagcccttgccagag
cccacagctgatgcagaggaacatacggagtgcgctgctcagtcggagtttaccgattca
gagacaattaatgaaacaccccaggaaaaaccacaggaggggagcctaccccaaagccca
gtccacacagaaggccaggaagttgctcccgaagctcccgtttccaaggatcagcccgac
agtacccctgaaaccaccgagctgcaggaaatccctaatatctgcaaagagctgcctgaa
ggggatgaatcagaaaagagcataaatcttcctgaggagtgcaaagctgaagagactgta
atggatttcagtcagccagcgtttaaagatgatgcagcgagcgtgcagggctgctccggc
catcaggtgacattagaagcaaacaggggtgccggcatcggcatcgtcatcactgtcacc
gaagccgaggactctgacaacaccgactctgaccaggcctacgagccatccccggttttg
caccgaaataagcaaaaagggaataaaaaatcaagcgggagctttgattttggtaaaaaa
gagggacccgaggctggcggtggtccccaggcagaggagaaaggtccgggcgaccaaggg
cacagaactggggagcagtacgaactgctcctcatagaaacggcgtcttcccttgtgaag
gcggccattcagtcatccatagagcagctggtcaacgaaatggccctggaacagaataaa
cacaacagtttcctgtga

DBGET integrated database retrieval system