KEGG   Egretta garzetta (little egret): 104132611Help
Entry
104132611         CDS       T05152                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00071  Fatty acid degradation
egz01212  Fatty acid metabolism
egz03320  PPAR signaling pathway
egz04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104132611 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104132611 (CPT1A)
   03320 PPAR signaling pathway
    104132611 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:egz03029]
    104132611 (CPT1A)
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     104132611 (CPT1A)
Mitochondrial biogenesis [BR:egz03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104132611 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 104132611
NCBI-ProteinID: XP_009644247
UniProt: A0A091IN03
Position
Unknown
AA seq 770 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRMSHEALKQIYLSGVHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDTTGYMSNQTQNIVSGILFGTGLWVALIV
TMRYSLKMLLSYHGWMFAEHGKLSAGTKFWMTLVKLFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVRPLMDDEEFRRMEGLAKDFAFNLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPIMVNSNYFAMDFLYLSPTTLQAARAGNVIHAILLYRKKLDRQEIKPILLMGST
VPLCSAQWERMFNTSRIPGEESDTLQHVKDSKHIVVYHKGRYFKVWLYHDGRLLKPREIE
QQMQRILDDDSEPQAGEEKLAALTAGDRVPWAKARQAYFSCGKNKQSLDAVEKAAFFVTL
DDIEQGYRKEDPVRSLDAYAKSLMHGRCYDRWFDKTFTLIVFKNGRMGLNAEHSWADAPI
VGHLWENVMATEYLELGYSEDGHCKGDINQNIPIPTKLQWEIPEECQEVIERSLSTAVAL
ADDVDFHSFFFGAFGKGLIKKAKTSPDAFVQLALQLAHYRDMGKFSLTYEASMTRLFREG
RTETVRSCTVESCNFVQTMEDPTESNENKLKFFRLAAAKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQHIDLKKNPEMLSCGGGFGPVADDGYGVS
YIILDENSIHFHVSSKISCPDTDSHRFGKNIQKAMVDIMGLFNLSKNCTK
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctcatcaagcagtagcttttcaattcacagtaactccagatgggattgac
ctgcgaatgagccatgaggcactcaaacaaatttacctatccggtgtccattcatggaag
aaaaagttcatcagattcaagaatggaattatcactggtgtttatcctgctagcccatct
agctggcttattgtagttgtgggtgtgatgtcaacaatgtatgccaaaattgatccttct
ttaggaataatagctaaaatcaaccgaacacttgatacaactggctatatgtcaaaccaa
acacagaacatcgtgagtggaatactttttggcacggggctttgggttgcccttattgtc
acaatgcgctactctctaaaaatgctgctttcctatcatggttggatgtttgctgaacat
ggcaaactttctgcaggcaccaagttttggatgacacttgtaaagctcttctcgggacgt
aaacccatgttatacagtttccagacatctttaccacgattgccagttccagcggttaaa
gacacagtcaataggtatctggaatcggttcggccacttatggatgatgaagagttcaga
agaatggagggtcttgccaaagattttgcatttaatttgggaccaaggcttcagtggtat
ttgaagctaaaatcctggtgggccacaaactatgttagtgattggtgggaagaatatatc
taccttagaggacgtggaccaattatggttaatagtaactattttgcaatggacttcctt
tatttatctcccacaaccctgcaggcagctagagctggtaatgttatccatgccatcctg
ctctatcggaaaaaactggacagacaagaaatcaagccaattcttctgatgggatctact
gttccactctgctcagctcagtgggagcggatgtttaatacctcccgtatcccaggagag
gaatcagatactctccagcatgtgaaagacagcaaacacattgttgtgtatcataagggc
cgttacttcaaagtgtggctgtaccatgatggtagactgttgaaaccccgcgaaattgaa
cagcagatgcaaagaattctcgatgatgattcagagcctcaggctggtgaagagaagcta
gcagctcttactgcaggagacagagtaccatgggctaaagctcggcaggcttattttagc
tgtggaaagaacaaacagtccttagatgctgttgaaaaagcagcattttttgtgacattg
gatgacatcgagcaagggtacaggaaagaagatccagtgaggtcactggatgcatatgcg
aaatccttaatgcatggcagatgttatgacaggtggtttgataaaacattcactcttata
gtattcaaaaatggcagaatgggtctgaatgcagagcactcttgggcagatgctcctatt
gttggacacctgtgggagaatgtaatggcaactgaatatcttgaactgggctattcagaa
gatgggcattgcaaaggagatatcaatcaaaatattcctattcctaccaaattacagtgg
gaaatcccagaagaatgtcaagaagtgattgagaggtctctgagcactgctgtagctctg
gcagatgatgtggacttccattcatttttctttggtgcttttgggaagggactaataaag
aaagctaaaaccagtcctgatgccttcgtgcagcttgccctccagcttgctcactatcgg
gacatgggaaaattttctttaacatatgaagcctctatgacacgcttgttccgagaaggg
aggaccgaaactgttcgttcgtgtactgttgaatcatgtaattttgttcaaaccatggaa
gacccaactgaaagtaatgaaaataagcttaagttctttcggcttgctgctgccaaacat
cagcacttgtatcgtcttgccatgactggtgctggcattgaccgccatctgttctgcctt
tatgtcgtgtcaaagtaccttgctgtagattctcctttccttaaagaagttttgtcagag
ccttggaggctgtcaacgagtcagacgccacagcaacacattgatttaaagaaaaaccct
gagatgttatcctgtggtggaggatttggaccggtggctgatgatggttacggtgtttct
tacattatcttggatgaaaattccatccatttccatgtgtccagcaaaatatcttgtcct
gacacggattctcatcgttttggaaaaaacatccaaaaagcaatggttgacatcatgggt
ttatttaaccttagtaaaaactgtaccaagtga

DBGET integrated database retrieval system