KEGG   Egretta garzetta (little egret): 104132781Help
Entry
104132781         CDS       T05152                                 

Gene name
ESPL1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104132781 (ESPL1)
   04114 Oocyte meiosis
    104132781 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:egz01002]
    104132781 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egz03036]
    104132781 (ESPL1)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     104132781 (ESPL1)
Peptidases and inhibitors [BR:egz01002]
 Cysteine peptidases
  Family C50: separase family
   104132781 (ESPL1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    104132781 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 104132781
NCBI-ProteinID: XP_009644410
Position
Unknown
AA seq 1864 aa AA seqDB search
VPSKDFRAIVYSSFSVLWKGADTLAKPDRPQEEGRAVLLTAQQAAAAAALYEAQRAPALA
FLGRQLGDCLLAALRREAEQPPTLQQSFCFFELTLEQCRHLCRSGRYEEAEQAVKDARGF
LGAAGSSAESFGDPLSLLEAGVQLSRVLAESTGPAGPPLSQAAVALGAAAEPWERILRVL
GESCQFIVSSLGEYLKRSKQQLLGREDVLGLCAFTEGHCRVLQQLLERVPPDGIKQKLMV
KQLLYRSVQLFSSVTCDTFQCSQAAGWPGLNQLTAGCGRIVVWMLEALEGLPEGERAKYL
DVTVSCMFKLAYIFYSQNLHGEATSVCELFCEKLQTADAYACPEIPPERLHKCFRLQVES
SRRLGQLEKALACVVQWLAALRGRIRELLAEPVSLWVRVKMDAARQGAGELRLRTLKDGL
EGHSLDSETLVTVLFAELKAYKTIRGDSGQERYNVLCDLLEICSEESGRLHERAVGLTEL
AQVLCYHSYAQQTDCSSLDSVHEALRLLDLIPKSAQNRDRLLDDRAQALLWLYICTLESM
LEKSIERDQRAKAEGVKNLDEFEPNDLNYEGRLLENSFLFSGISFNLATETGEDAAGFGP
LVKRLSGSAWFRVGVSQTCGVPSALSKSLDDAFNLWKQLLAMPGVPAVRSPEQTVASLHI
LAALYKLMAKPFQAMESYLLVRALCSALGDNLGMASALCQVTKLLFQLECPSYAQLYLEE
MESCLQKANSSEDSYLLLQQTCLLLRSQLCCVNHQVEEGLTLLLGVLQNPALQKAAKVWY
LLRAHVLQLAAVYLSLSPAHLSPELQQRIFVQGWKTPETALAEAHKLFRSIILLLMESDV
LGCQTASGVQFVDYGDNLLLKWQVLADMLACSEHLVALLSRMEVVCKAKAFCLEGVKLAV
KLQAIRWCTAFLVLKAQLELQQSELELSHFALQQALFLLESDTEFKAIEKQNAQVKILPR
KGKPEGKKPQDPTSEPPEEDEGFLKGPPLEFVAMVSRPEQADALSASPELKPRRRKRLAF
LPHPAACLCCLCSDLALSALCLRWLLSCARGELAAGSVAEGLDLVRAVLLRCAAVATRFA
TVLRDKLWDGSAGRALPALELLHDLGATDKAQPQRRKTKATSAPAVSKPRVKKSQRAKPL
AVPSTNDVFALDESDSKVPPIVIRSVTVLCTPHQKACPPTKAQAVPGPRTPFTIFSESSP
PPGKSRVLRAPRCLGRVKSRLRVRRPGTRRAGAAEEKRERVTRRAPSKRAEEEWELLRAI
EEEKVEEELEISLEVLQVSDEEEEASGRRRLPRRRQKGADGKHKVLQQEDGEDVPAAQRP
SSGDTLCLEGTLSSTLPTAGDVSSQDEVLKLLKDALNCISRCPPGTLYSQLCQLLALATG
NQDPLSTAYLLSESVSVTARHQLLSVIHRKIYKEKKAAGDVAKLLCGLSLQEGSAAQCSH
HLAELERLFVFSSTGLGSEVQDSFRTQLQEIPSGVTVCLLTLASIQPGSTGGTLLLTRLE
KDTAPVTIRIPTALGKAPVCSVLREFEAIQKEQKETNNCTEKRDWWQRRSELDRRMKSII
ETLEMEVLGCWKGALIPTSPEPGLAEEAARLHPQLCRCGWRDSDPTLLKRASGAGPAQPS
QAELLLQEAVEKRGACTTQNGGSLVLVLDKHLQKLPWESMACLKAVPVTRLPSLRFLLSY
SLAQKRQAGSVLNCGVNPSSTFYVLNPHRNLASLGGLFWGHPRAGWGTRAAWGSPGGGAS
PRSYAGHGAGAHFLDGQTIARLDCRAVTLLFGCSSAALAVRGSLEGSGIVLKYIMAGCPL
VLGNLWDVTDGDIDRYTQALLQGWLRGGSGAPFLSYVAQARQAPRLKYLIGAAPVAYGLP
VFLQ
NT seq 5595 nt NT seq  +upstreamnt  +downstreamnt
gtgccctccaaggacttcagagccatcgtctacagcagcttcagcgtgctctggaaaggg
gcggacaccttggccaagcccgaccgcccgcaggaggagggtagagccgtccttttgaca
gcgcagcaggcggcggctgctgccgccctgtatgaagcccagcgggcgccggccttggct
ttcctcggccgacagctcggggactgcttgctcgcggctctgcgaagggaggcagagcag
ccgcccaccctccagcaatccttctgcttctttgagctcaccctggagcagtgccggcat
ctctgcaggagcggccggtacgaggaggctgagcaggcagtaaaggatgcgaggggcttc
ttgggggccgccggcagctctgcagaatcttttggtgaccctctgtccctcctggaggcc
ggggtccagctgagccgggtgctggccgagagcactggccctgctgggccacccttgtcc
caggctgcggtggctcttggtgcggcggcggagccctgggagcggatcctcagggtgctg
ggtgagagctgccagttcatcgtctcctccctcggcgagtacctgaagaggagcaagcag
cagctcttgggccgggaggacgtgctcggcctctgtgccttcaccgaggggcactgccgt
gtcctccagcagctgctggagagggttcctcctgatggtatcaagcagaagctcatggta
aagcagctgctctaccgcagcgtccagctcttttctagcgtgacctgtgacaccttccag
tgctcccaggcggcgggctggccgggtctgaaccagctgacggcgggctgcggaaggatc
gtggtgtggatgctggaggcgttggaggggctccctgagggcgagcgagccaagtacctg
gacgtgactgtgtcgtgcatgttcaagctggcctacatcttctacagtcagaaccttcac
ggggaggccacctctgtctgcgagctcttctgcgagaagctgcagacagcagatgcctac
gcgtgtccagagatacccccagagcggctgcacaaatgcttcaggctgcaggtggaaagc
tcccgcaggctggggcagctggagaaagccctggcgtgcgtggtgcagtggctggccgcc
ctgcggggccggatccgggagctgctggcagagcccgtctccctctgggtcagagtcaag
atggatgctgcgagacagggggctggggagctacggttacggaccctgaaggatggcttg
gaggggcacagtctggactcggagaccttggtgaccgtcctcttcgcggagctgaaggcc
tacaagaccatccgaggcgactcggggcaggaacgctacaacgtcctctgcgacctgctg
gagatctgctcggaggagagcggccgcctgcacgagcgagccgttggcttgacggagctg
gcccaggtcttgtgctaccacagctacgcccagcagacggactgctcctccctggactcg
gtccatgaagccttgcggctgctcgacttgatacccaaaagcgctcagaatcgggaccgg
ctcctcgatgaccgggcgcaggctctgctctggctctacatctgcaccctggagtccatg
ctggagaagagcatagagagggaccagagagccaaagctgagggggtgaagaacctggac
gagtttgagcccaatgacctcaactacgaaggcaggctgctggagaacagcttcctgttc
agcggcatctccttcaacctggcgacagagactggtgaggatgctgccggctttgggccc
ttggtgaagaggctctctgggagcgcctggtttcgggttggggtgtctcagacctgtggt
gtgccctcagctctgtccaaaagcctggatgatgccttcaacttgtggaagcagctcctg
gcgatgccgggcgtcccggccgtccgcagccctgagcagaccgtggcttccctgcacatc
ctagcggctctctacaagctgatggccaagccctttcaagccatggagagctacctcctg
gtcagagccctgtgcagcgccctcggggacaacctgggaatggccagtgccctgtgccag
gtcaccaagctgctcttccagctggagtgtcccagctacgcccagctttatctggaggag
atggagtcctgcctgcagaaagccaacagcagtgaggattcctacctgctgctgcagcaa
acctgcctcctgctccgtagccagctgtgctgtgtcaaccaccaggttgaagaaggtctc
accctgctgctgggggtgctccagaacccggctctgcaaaaagccgcgaaggtctggtac
ctgctgcgagcccacgtccttcagctggccgccgtctacctgagcctctcccctgcccac
ctctcaccggagctccagcagcgcatctttgtgcaagggtggaagacgcccgagacggct
ctggccgaagcccacaagctcttccgcagcatcatcctcctgctgatggagagcgacgtg
ctgggctgtcagacagcatcaggcgtccagtttgtggattacggggacaacctgctgctg
aagtggcaagtgctagccgacatgctggcctgctcggagcacctggtggcccttctcagc
aggatggaggtggtgtgtaaagccaaagccttctgcctggagggcgtcaagctggccgtg
aaactgcaagccatccggtggtgtactgcattcctggtgctgaaggcccagctggagctg
cagcagagcgagctggagctgagccacttcgccctccagcaggctctcttcctcctggag
tccgacaccgagtttaaagccatcgagaagcagaatgcccaggtgaagatcctgcccagg
aagggcaaacccgagggcaagaagccacaggaccccacctcggagccccctgaggaagat
gagggtttcctaaagggccctccgctggagtttgtggccatggtgagcaggccagagcag
gcggatgctctctcagcctcaccggagctgaagcccaggaggaggaagagactggccttc
ctcccccacccggcagcctgcctgtgctgcctctgctccgacctggccctctcggctctc
tgcctgcgctggctcctgtcctgcgcccggggcgagctggcagcgggcagcgtggccgag
gggctggatctggtccgtgccgtgctgctgcgctgcgccgccgtggccacccgctttgcc
accgtgctgcgagacaagctgtgggacggctctgccggccgggccctgcctgcgctggag
ctgctgcacgatctgggggccacggacaaggctcagccccaaaggcgcaaaaccaaggca
acgtcagcccccgccgtgtccaagcccagagtgaagaaaagccagagagcaaagcccctg
gctgtgccgagcaccaacgacgtctttgctctggatgagtcggacagcaaggtccccccc
atcgtcatccggtcggtgacggtgctgtgcaccccgcaccagaaagcctgtccccccacc
aaggcacaggctgtccctggccccaggactcccttcacgatcttcagcgaatcctccccg
ccgcctggcaagtctcgggttctccgggcgcccagatgcttgggaagagtcaaatctcgc
ctccgggtgaggcggccaggcacccgccgagccggggctgcggaggagaagagggagcgg
gtgacccgcagggctcccagcaagagagcggaggaggagtgggagcttctgagggccatt
gaggaagagaaggtggaggaagagcttgagatcagcttggaggtcttgcaggtctccgat
gaagaggaggaagcctcaggcaggagacggctgccccggcgcaggcagaagggtgcagat
gggaagcacaaagtcctgcagcaagaggatggtgaggatgtcccggcagcacagcggccg
agcagcggggacaccctgtgcctggaggggaccctctcctccaccctgcccacggctggt
gatgtctcctcacaggacgaggtcctcaagctcttgaaagatgctctcaactgcatcagc
cgctgccctcccggtacgctctacagccagctctgccagctcctggcgctggccacgggg
aaccaggaccctctctccaccgcgtatctgctctctgagtcggtctccgtcaccgctcgc
catcagctgctcagcgtcatccacaggaagatttacaaagagaagaaggcagcaggggac
gtggccaagctgctctgtgggctctccttgcaggaggggagcgctgcccagtgcagccac
caccttgccgagctggagaggctctttgtgttcagctccacagggctgggctctgaggtg
caggacagcttccggacgcagctgcaggagatccccagtggggtgacggtgtgcctgttg
accctcgccagcatccagcctggctctacagggggcacgctgctcctgacgcggctggag
aaggacacggctcccgtgaccatccgcatccccactgcgctcggcaaggccccggtgtgc
tcggtgctgagagaatttgaagccatccagaaggagcagaaggaaaccaacaactgcacg
gagaagcgagactggtggcagcgccgctccgagctggaccggaggatgaagagcatcatc
gagaccctggagatggaggtgctgggctgctggaagggtgccctgatccccaccagccct
gagcccggtctggcagaggaagccgcccgcttgcacccccagctctgccggtgtggctgg
agggactcggatcccaccctgctcaagcgggcctccggcgccggcccggcgcagcccagc
caggctgagctcctcttgcaggaggcggtggagaagcggggagcctgcaccacgcagaac
ggtggctccctcgtcctggtgctggataagcacctgcagaagctgccctgggagagcatg
gcgtgcctgaaggccgtgcccgtaaccaggctcccttccctgcgcttcctcctcagctac
tccctggcacagaagcggcaggcggggtctgtgctgaactgcggcgtgaaccccagcagc
accttctacgtcctcaacccccacaggaacctngcatcactgggggggctgttttgggga
caccccagggcagggtggggtacgagagcagcctggggctcacctggggggggtgcttct
ccccgtagttacgcggggcatggagcaggcgcccactttttggatggacagaccatcgcc
cggctggattgccgcgctgtcaccctgcttttcggctgcagcagcgccgcgcttgctgtc
cgtggcagcctggagggctctggcatcgtcctcaagtacatcatggccggctgccccctc
gtcctggggaacctgtgggacgtgacggatggggacatcgaccgctacacccaggcactg
ctgcagggctggctgagggggggctcgggcgcccccttcctctcctacgttgcccaggcc
cgccaagcccccagactcaaatacctcatcggggcggcccctgttgcctacgggctgcct
gtcttcctgcagtga

DBGET integrated database retrieval system